BLASTP 2.2.31+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: uniprot-human-reactome.fasta
           7,664 sequences; 4,589,100 total letters



Query= Pcr_R007201

Length=2043
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  sp|P35556|FBN2_HUMAN Fibrillin-2 OS=Homo sapiens GN=FBN2 PE=1 SV=3  3796    0.0   
  sp|Q75N90|FBN3_HUMAN Fibrillin-3 OS=Homo sapiens GN=FBN3 PE=2 SV=3  2887    0.0   
  sp|P35555|FBN1_HUMAN Fibrillin-1 OS=Homo sapiens GN=FBN1 PE=1 SV=3  2502    0.0   
  sp|Q8N2S1|LTBP4_HUMAN Latent-transforming growth factor beta-bi...  433     5e-125
  sp|Q14766|LTBP1_HUMAN Latent-transforming growth factor beta-bi...  432     3e-124
  sp|Q14767|LTBP2_HUMAN Latent-transforming growth factor beta-bi...  395     4e-112
  sp|Q9NS15|LTBP3_HUMAN Latent-transforming growth factor beta-bi...  330     1e-92 
  sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 ...  252     2e-67 
  sp|P46531|NOTC1_HUMAN Neurogenic locus notch homolog protein 1 ...  236     2e-62 
  sp|Q9UM47|NOTC3_HUMAN Neurogenic locus notch homolog protein 3 ...  225     3e-59 
  sp|P98095|FBLN2_HUMAN Fibulin-2 OS=Homo sapiens GN=FBLN2 PE=1 SV=2  199     8e-52 
  sp|Q99466|NOTC4_HUMAN Neurogenic locus notch homolog protein 4 ...  183     1e-46 
  sp|P23142|FBLN1_HUMAN Fibulin-1 OS=Homo sapiens GN=FBLN1 PE=1 SV=4  167     1e-42 
  sp|Q9NQ36|SCUB2_HUMAN Signal peptide, CUB and EGF-like domain-c...  149     2e-36 
  sp|O95967|FBLN4_HUMAN EGF-containing fibulin-like extracellular...  144     5e-36 
  sp|Q12805|FBLN3_HUMAN EGF-containing fibulin-like extracellular...  138     5e-34 
  sp|Q9UBX5|FBLN5_HUMAN Fibulin-5 OS=Homo sapiens GN=FBLN5 PE=1 SV=1  134     7e-33 
  sp|Q9Y219|JAG2_HUMAN Protein jagged-2 OS=Homo sapiens GN=JAG2 P...  127     1e-29 
  sp|Q14246|EMR1_HUMAN EGF-like module-containing mucin-like horm...  122     3e-28 
  sp|Q9UHX3|EMR2_HUMAN EGF-like module-containing mucin-like horm...  117     1e-26 
  sp|P48960|CD97_HUMAN CD97 antigen OS=Homo sapiens GN=CD97 PE=1 ...  116     3e-26 
  sp|O95460|MATN4_HUMAN Matrilin-4 OS=Homo sapiens GN=MATN4 PE=1 ...  104     5e-23 
  sp|Q14393|GAS6_HUMAN Growth arrest-specific protein 6 OS=Homo s...  99.8    2e-21 
  sp|P78504|JAG1_HUMAN Protein jagged-1 OS=Homo sapiens GN=JAG1 P...  95.9    7e-20 
  sp|P07225|PROS_HUMAN Vitamin K-dependent protein S OS=Homo sapi...  93.2    3e-19 
  sp|P01133|EGF_HUMAN Pro-epidermal growth factor OS=Homo sapiens...  92.8    6e-19 
  sp|O60494|CUBN_HUMAN Cubilin OS=Homo sapiens GN=CUBN PE=1 SV=5      92.8    8e-19 
  sp|P14543|NID1_HUMAN Nidogen-1 OS=Homo sapiens GN=NID1 PE=1 SV=3    87.4    3e-17 
  sp|P07204|TRBM_HUMAN Thrombomodulin OS=Homo sapiens GN=THBD PE=...  85.9    4e-17 
  sp|Q14112|NID2_HUMAN Nidogen-2 OS=Homo sapiens GN=NID2 PE=1 SV=3    86.3    6e-17 
  sp|O15232|MATN3_HUMAN Matrilin-3 OS=Homo sapiens GN=MATN3 PE=1 ...  82.0    5e-16 
  sp|O00548|DLL1_HUMAN Delta-like protein 1 OS=Homo sapiens GN=DL...  74.3    2e-13 
  sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens GN=STAB2 PE=1 ...  73.9    4e-13 
  sp|Q9NY15|STAB1_HUMAN Stabilin-1 OS=Homo sapiens GN=STAB1 PE=1 ...  68.9    1e-11 
  sp|P98164|LRP2_HUMAN Low-density lipoprotein receptor-related p...  68.2    2e-11 
  sp|Q8NFT8|DNER_HUMAN Delta and Notch-like epidermal growth fact...  67.0    3e-11 
  sp|O75096|LRP4_HUMAN Low-density lipoprotein receptor-related p...  62.0    2e-09 
  sp|Q9NR61|DLL4_HUMAN Delta-like protein 4 OS=Homo sapiens GN=DL...  61.2    2e-09 
  sp|P01130|LDLR_HUMAN Low-density lipoprotein receptor OS=Homo s...  60.5    3e-09 
  sp|Q14114|LRP8_HUMAN Low-density lipoprotein receptor-related p...  60.8    3e-09 
  sp|Q07954|LRP1_HUMAN Prolow-density lipoprotein receptor-relate...  60.5    4e-09 
  sp|P49747|COMP_HUMAN Cartilage oligomeric matrix protein OS=Hom...  59.7    6e-09 
  sp|O75093|SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens GN...  59.7    7e-09 
  sp|P35443|TSP4_HUMAN Thrombospondin-4 OS=Homo sapiens GN=THBS4 ...  58.9    1e-08 
  sp|O75094|SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens GN...  52.0    2e-06 
  sp|P21941|MATN1_HUMAN Cartilage matrix protein OS=Homo sapiens ...  50.1    5e-06 
  sp|P80370|DLK1_HUMAN Protein delta homolog 1 OS=Homo sapiens GN...  48.9    8e-06 


> sp|P35556|FBN2_HUMAN Fibrillin-2 OS=Homo sapiens GN=FBN2 PE=1 
SV=3
Length=2912

 Score = 3796 bits (9845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1899/2048 (93%), Positives = 1973/2048 (96%), Gaps = 10/2048 (0%)

Query  1     DYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNI  60
             DYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNI
Sbjct  210   DYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNI  269

Query  61    RTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGIC  120
             RTGACQDVDECQAIPG+CQGGNCINTVGS+EC+CPAGHKQ+E TQKC+DIDECSIIPGIC
Sbjct  270   RTGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGIC  329

Query  121   EGSECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQELPGRFTKRQCC  180
             E  ECSNTVGSYFC+CPRGYVTSTDGSRCIDQR   CFS +VNGRCAQELPGR TK QCC
Sbjct  330   ETGECSNTVGSYFCVCPRGYVTSTDGSRCIDQRTGMCFSGLVNGRCAQELPGRMTKMQCC  389

Query  181   CESGRCWAMGSVPEMCPVRGSDEYRRLCVDGAPAGG-----GSRGGGTGGNGFLPSGNGN  235
             CE GRCW +G++PE CPVRGS+EYRRLC+DG P GG     GSR GGTGGNGF PSGNGN
Sbjct  390   CEPGRCWGIGTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNGN  449

Query  236   GHGHGPRGAGFIPIPGSNGFSPGVGGAGVGTGSSTGNGPIITGLTILNQTIDICKHHPDL  295
             G+G    G GFIPIPG NGFSPGVGGAGVG G      PIITGLTILNQTIDICKHH +L
Sbjct  450   GYGP--GGTGFIPIPGGNGFSPGVGGAGVGAGGQG---PIITGLTILNQTIDICKHHANL  504

Query  296   CLNGRCIPTLSSYRCECNMGYKQDSNGDCTDVDECTSNPCSNGDCVNTPGSYYCKCHAGF  355
             CLNGRCIPT+SSYRCECNMGYKQD+NGDC DVDECTSNPC+NGDCVNTPGSYYCKCHAGF
Sbjct  505   CLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNPCTNGDCVNTPGSYYCKCHAGF  564

Query  356   QRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTT  415
             QRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTT
Sbjct  565   QRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTT  624

Query  416   NMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCEC  475
             NMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTD+DECQT GICMNGHCIN+EGSFRC+C
Sbjct  625   NMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCINSEGSFRCDC  684

Query  476   PPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPC  535
             PPGLAVG+DGRVCVDTHMRSTCYGGIKKG CVRPFPGAVTKSECCCANPDYGFGEPC PC
Sbjct  685   PPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPC  744

Query  536   PAKNSAEFHGLCSSGIGITVDGRDINECALDPDICSNGICENLRGSYRCNCNSGYEPDPS  595
             PAKNSAEFHGLCSSG+GITVDGRDINECALDPDIC+NGICENLRGSYRCNCNSGYEPD S
Sbjct  745   PAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDAS  804

Query  596   GRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINECESSPCVNG  655
             GRNC+DIDEC VNRLLCDNGLCRNTPGSYSCTCP GYVF TET+TCEDINECES+PCVNG
Sbjct  805   GRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNPCVNG  864

Query  656   ACRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATL  715
             ACRNNLGSFNCECSPGSKL STGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATL
Sbjct  865   ACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATL  924

Query  716   GAAWGSPCERCELDTACSRGFARVNGVTCEDVNECDVFPGVCPNGRCINSRGSFHCECPE  775
             GAAWGSPCERCELDTAC RG AR+ GVTCEDVNEC+VFPGVCPNGRC+NS+GSFHCECPE
Sbjct  925   GAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPE  984

Query  776   GLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKPD  835
             GLTLDGTGRVCLDIRMEQCYL WDEDECI  VPGKFRMDACCCAVGAAWG++CEECPKP 
Sbjct  985   GLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPG  1044

Query  836   TKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGF  895
             TKEYE LCPRG GF+NRGD+LTGRPFYKDINECK FPGMC  GKCRNTIGSFKC+CNSGF
Sbjct  1045  TKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGF  1104

Query  896   TLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECER  955
              LDMEERNCTDIDEC ISPDLCGSG CVNTPGSFECECF+GYESGFMMMKNCMDIDECER
Sbjct  1105  ALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECER  1164

Query  956   NPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQ  1015
             NPLLCRGGTCVNTEGSFQCDCPLGHELSPSRE+C+D+NECSLSD+LCRNGKCVNM+GTYQ
Sbjct  1165  NPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQ  1224

Query  1016  CSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADI  1075
             CSCN GYQATPDR+ CTDIDECMIMNGGC T CTNSEGSYECSCS+GYALMPD R+CADI
Sbjct  1225  CSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADI  1284

Query  1076  DECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENT  1135
             DECE+NPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENT
Sbjct  1285  DECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENT  1344

Query  1136  KGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGI  1195
             KGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASC+N+PGSFKCSCREGW+GNGI
Sbjct  1345  KGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGI  1404

Query  1196  KCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECAENVHLCENGQ  1255
             KCIDLDECSNGTHQCS+NAQCVN+PGSY CAC EGFTGDGFTCSDVDECAEN++LCENGQ
Sbjct  1405  KCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQ  1464

Query  1256  CLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYELD  1315
             CLNVPGAYRCECEMGFTPASDS+SCQDI+ECSFQNICVFGTCNNLPGMFHCICDDGYELD
Sbjct  1465  CLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELD  1524

Query  1316  RTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKYG  1375
             RTGGNCTD+DECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLK+G
Sbjct  1525  RTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFG  1584

Query  1376  PRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNPI  1435
             PRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEY TLCPGGEGFRPNPI
Sbjct  1585  PRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPI  1644

Query  1436  TIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCG  1495
             TIILEDIDECQELPGLCQGGNCINTFGSFQCECP+GYYLSE+TRICEDIDEC AHPGVCG
Sbjct  1645  TIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDECFAHPGVCG  1704

Query  1496  PGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCC  1555
             PGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGT+CENELPFNVTKRMCCC
Sbjct  1705  PGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCC  1764

Query  1556  TYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICANGVC  1615
             TYNVGKAWNKPCEPCPTPGTA+FK ICGNIPGFTFDIH+GKAVDIDECKEIPGICANGVC
Sbjct  1765  TYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVC  1824

Query  1616  INQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKL  1675
             INQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKL
Sbjct  1825  INQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKL  1884

Query  1676  SPNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPCG  1735
             SPNGACVDRNECLEIPNVCSHGLCVD+QGSY+CICHNGFKASQDQTMCMDVDECERHPCG
Sbjct  1885  SPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPCG  1944

Query  1736  NGTCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEG  1795
             NGTCKNTVGSYNCLCYPGFELTHNNDC+DIDECSSFFGQVCRNGRCFNEIGSFKCLCNEG
Sbjct  1945  NGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEG  2004

Query  1796  YELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSESCIDINECNEDP  1855
             YELT DGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSE+CIDINEC+EDP
Sbjct  2005  YELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSENCIDINECDEDP  2064

Query  1856  NICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKA  1915
             NICLFGSCTNTPGGFQC+CP GFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKA
Sbjct  2065  NICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKA  2124

Query  1916  KCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSN  1975
             KCCCSKMPGEGWGDPCELCPK++EVAFQDLCPYGHGT+P + DTREDVNECLESPG+CSN
Sbjct  2125  KCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSN  2184

Query  1976  GHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGNGTCTNVIGSFECNCHEGFE  2035
             G CINTDGSFRCECPMGYNLDYTGV C+DTDECSIGNPCGNGTCTNVIGSFECNC+EGFE
Sbjct  2185  GQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCTNVIGSFECNCNEGFE  2244

Query  2036  PGPMMNCE  2043
             PGPMMNCE
Sbjct  2245  PGPMMNCE  2252


 Score = 853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/1973 (34%), Positives = 899/1973 (46%), Gaps = 340/1973 (17%)

Query  1     DYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNI  60
             D   G C+  + +  C+  + G    K+ CCAT+G AWG PCE C      C RG     
Sbjct  892   DSLKGTCWLNIQDSRCEVNINGAT-LKSECCATLGAAWGSPCERCELD-TACPRGLA---  946

Query  61    RTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGIC  120
                          I GV                             C+D++EC + PG+C
Sbjct  947   ------------RIKGV----------------------------TCEDVNECEVFPGVC  966

Query  121   EGSECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQELPGRFTKRQCC  180
                 C N+ GS+ C CP G      G  C+D R   C+       C   +PG+F    CC
Sbjct  967   PNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACC  1026

Query  181   CESGRCWAMGSVPEMCPVRGSDEYRRLCVDGAPAGGGSRGGGTGGNGFLPSGNGNGHGHG  240
             C  G  W  G+  E CP  G+ EY  LC  GA  G  +RG    G  F    N       
Sbjct  1027  CAVGAAW--GTECEECPKPGTKEYETLCPRGA--GFANRGDVLTGRPFYKDINE------  1076

Query  241   PRGAGFIPIPGSNGFSPGVGGAGVGTGSSTGNGPIITGLTILNQT-IDICKHHPDLCLNG  299
                      PG   +  G     +G+     N      +   N T ID C+  PDLC +G
Sbjct  1077  -----CKAFPGMCTY--GKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSG  1129

Query  300   RCIPTLSSYRCECNMGYKQD--SNGDCTDVDECTSNP--CSNGDCVNTPGSYYCKCHAGF  355
              C+ T  S+ CEC  GY+       +C D+DEC  NP  C  G CVNT GS+ C C  G 
Sbjct  1130  ICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGH  1189

Query  356   QRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTT  415
             + +P+++ C+DI+EC  +  LC+NG+CVN  G++QC CN G++ T D + C D DEC   
Sbjct  1190  ELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIM  1249

Query  416   NMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQT--------------------  455
             N   +  C N +GS++C C  G+ L P+GR C DIDEC+                     
Sbjct  1250  NGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCL  1309

Query  456   -----------------------SGICMNGHCINTEGSFRCECPPGLAVGVDGRVCVDTH  492
                                    S ICM G C NT+GSF C C  G +V      C D  
Sbjct  1310  CYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVD  1369

Query  493   MRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPC----------HPCP-----A  537
                         A     PG+    +C C     G G  C          H C       
Sbjct  1370  ECEIGAHNCDMHASCLNIPGSF---KCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCV  1426

Query  538   KNSAEFHGLCSSGIGITVDG---RDINECALDPDICSNGICENLRGSYRCNCNSGYEPDP  594
                  +   CS G   T DG    D++ECA + ++C NG C N+ G+YRC C  G+ P  
Sbjct  1427  NTPGSYRCACSEGF--TGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPAS  1484

Query  595   SGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINEC-ESSPCV  653
               R+C DIDECS   + C  G C N PG + C C  GY        C DI+EC +   CV
Sbjct  1485  DSRSCQDIDECSFQNI-CVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCV  1543

Query  654   NGACRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDS-----RCEVNINGATLK  708
             NG C N  G + C C P  +L+ TG+ C+D+  G C+L           C   I     +
Sbjct  1544  NGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSR  1603

Query  709   SECCATLGAAWGSPCERC------ELDTACSRGFA-RVNGVT--CEDVNECDVFPGVCPN  759
             S CC +LG AWG+PCE C      E  T C  G   R N +T   ED++EC   PG+C  
Sbjct  1604  SSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQG  1663

Query  760   GRCINSRGSFHCECPEGLTLDGTGRVC---------------------------------  786
             G CIN+ GSF CECP+G  L    R+C                                 
Sbjct  1664  GNCINTFGSFQCECPQGYYLSEDTRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEY  1723

Query  787   ---------LDIRMEQCYLTWDEDECIRSVPGKFRMDACCCA--VGAAWGSDCEECPKPD  835
                      +D+R   CY +++   C   +P       CCC   VG AW   CE CP P 
Sbjct  1724  MQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPG  1783

Query  836   TKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGF  895
             T +++ +C   PGF+   DI TG+    DI+ECK  PG+C NG C N IGSF+C+C +GF
Sbjct  1784  TADFKTICGNIPGFTF--DIHTGKAV--DIDECKEIPGICANGVCINQIGSFRCECPTGF  1839

Query  896   TLDMEERNCTDIDECWISPDLCG-SGTCVNTPGSFECECFDGYE----------------  938
             + +     C DIDEC    +LC  +  C+N+PGS+ CEC  G++                
Sbjct  1840  SYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEI  1899

Query  939   ---------------------SGFMMMKN---CMDIDECERNPLLCRGGTCVNTEGSFQC  974
                                  +GF   ++   CMD+DECER+P  C  GTC NT GS+ C
Sbjct  1900  PNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHP--CGNGTCKNTVGSYNC  1957

Query  975   DCPLGHELSPSREECIDVNECS-LSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTD  1033
              C  G EL+    +C+D++ECS     +CRNG+C N +G+++C CN GY+ TPD ++C D
Sbjct  1958  LCYPGFELT-HNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCID  2016

Query  1034  IDECMIMNGGCHT-HCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTN  1092
              +EC+ + G C    C N EGS+ C C  GY +  +   C DI+EC+ +P+IC  G CTN
Sbjct  2017  TNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSE--NCIDINECDEDPNICLFGSCTN  2074

Query  1093  IPGEYRCLCYDGFMASMDMKTCIDVNE----CDLNSNICMFGECENTKGSFIC-------  1141
              PG ++CLC  GF+ S + + C D  +     +  +  C   +  NT  +  C       
Sbjct  2075  TPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGE  2134

Query  1142  -------------------HCQLGY-SVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGS  1181
                                 C  G+ +V        DV+EC      C  +  C+N  GS
Sbjct  2135  GWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICS-NGQCINTDGS  2193

Query  1182  FKCSCREGWVGN--GIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFT-GDGFTC  1238
             F+C C  G+  +  G++C+D DECS G + C  N  C N  GS+ C C EGF  G    C
Sbjct  2194  FRCECPMGYNLDYTGVRCVDTDECSIG-NPCG-NGTCTNVIGSFECNCNEGFEPGPMMNC  2251

Query  1239  SDVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECS--FQNICVFGT  1296
              D++ECA+N  LC   +C+N  G+Y C C +G+    D K C+D++EC+    +    G 
Sbjct  2252  EDINECAQNPLLCAF-RCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGM  2310

Query  1297  -CNNLPGMFHCICDDGYELDRTGGNCTDVDEC-ADPINCVNGLCVNTPGRYECNCPPDFQ  1354
              C NL G F CIC  G      G  C D +EC   P  C NG CVN  G Y C C   FQ
Sbjct  2311  MCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQ  2370

Query  1355  LNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPP  1414
              + +G  C+DNR G C+ +         S +  +   V++S CCC  G+ WG+ CE CP 
Sbjct  2371  SSSSGTECLDNRQGLCFAEVLQTICQMASSSRNL---VTKSECCCDGGRGWGHQCELCPL  2427

Query  1415  VNSTEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYL  1474
               + +Y  +CP G G+     T    DIDEC+ +P LC  G CINT GSF+C C  GY  
Sbjct  2428  PGTAQYKKICPHGPGY-----TTDGRDIDECKVMPNLCTNGQCINTMGSFRCFCKVGYTT  2482

Query  1475  SEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRS  1534
                   C D+DEC   P  C    C NT G+Y C CP  Y+    G  C D+ +      
Sbjct  2483  DISGTSCIDLDECSQSPKPCNY-ICKNTEGSYQCSCPRGYVLQEDGKTCKDLDEC-----  2536

Query  1535  YNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHS  1594
                           TK+  C    V       C+ CP              PGFT   H 
Sbjct  2537  -------------QTKQHNCQFLCVNTLGGFTCK-CP--------------PGFT--QHH  2566

Query  1595  GKAVDIDECKEIPGIC-ANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQ  1653
                +D +EC   P +C A G+C N  GSF CEC  GFS +   L CED+DEC +G++ CQ
Sbjct  2567  TACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDEC-DGNHRCQ  2625

Query  1654  RNADCINSPGSYRCECAAGF-KLSPNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHN  1712
                 C N  G YRC C  G+ +      CVD NEC   PN C    C +  GSYKC C +
Sbjct  2626  HG--CQNILGGYRCGCPQGYIQHYQWNQCVDENECSN-PNACGSASCYNTLGSYKCACPS  2682

Query  1713  GFKASQDQTMCMDVDECE--RHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCM  1763
             GF   Q  + C DV+EC   ++PC  G C NT G Y C C PG+       C+
Sbjct  2683  GFSFDQFSSACHDVNECSSSKNPCNYG-CSNTEGGYLCGCPPGYYRVGQGHCV  2734


 Score = 847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 741/2253 (33%), Positives = 1011/2253 (45%), Gaps = 380/2253 (17%)

Query  63    GACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICEG  122
             G C DVDEC + P  C  G+C+NT GSY CKC AG ++    Q C DIDEC     +C+ 
Sbjct  531   GDCIDVDECTSNP--CTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKN  588

Query  123   SECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQELPGRFTKRQCCCE  182
               C NT GS+ CIC  G+  +TDG  C+D    T  +  +NG C  E  G F   +C C+
Sbjct  589   GRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINE-DGSF---KCICK  644

Query  183   SGRCWAMGSVPEMCPVRGSDEYRRLCVDG--APAGGGSR-----GGGTGGNGFL---PSG  232
              G  + +      C      +   +C++G    + G  R     G   G +G +      
Sbjct  645   PG--FVLAPNGRYCTDVDECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHM  702

Query  233   NGNGHGHGPRGAGFIPIPGS------------NGFS------PGVGGAGVGTGSSTGNGP  274
                 +G   +G    P PG+             GF       P    A      S+G   
Sbjct  703   RSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSG---  759

Query  275   IITGLTILNQTIDICKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNG-DCTDVDECTSN  333
                G+T+  + I+ C   PD+C NG C     SYRC CN GY+ D++G +C D+DEC  N
Sbjct  760   --VGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVN  817

Query  334   P--CSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQC  391
                C NG C NTPGSY C C  G+      + C DI+EC  N   C NG C N  GSF C
Sbjct  818   RLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESN--PCVNGACRNNLGSFNC  875

Query  392   ICNAGFELTTDGKNCVDHDECT--------TTNMCLNGMCINED------GSFKCICK--  435
              C+ G +L++ G  C+D  + T           + +NG  +  +       ++   C+  
Sbjct  876   ECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERC  935

Query  436   ------PGFVLAPNGRYCTDIDECQT-SGICMNGHCINTEGSFRCECPPGLAVGVDGRVC  488
                   P  +    G  C D++EC+   G+C NG C+N++GSF CECP GL +   GRVC
Sbjct  936   ELDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVC  995

Query  489   VDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGLCS  548
             +D  M   CY    +  C+ P PG      CCCA     +G  C  CP   + E+  LC 
Sbjct  996   LDIRMEQ-CYLKWDEDECIHPVPGKFRMDACCCA-VGAAWGTECEECPKPGTKEYETLCP  1053

Query  549   SGIGITVDG---------RDINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNC  599
              G G    G         +DINEC   P +C+ G C N  GS++C CNSG+  D   RNC
Sbjct  1054  RGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNC  1113

Query  600   VDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFS-TETDTCEDINECESSP--CVNGA  656
              DIDEC ++  LC +G+C NTPGS+ C C +GY         C DI+ECE +P  C  G 
Sbjct  1114  TDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGT  1173

Query  657   CRNNLGSFNCECSPGSKLDSTGLICID----SLK------GTCWLNIQDSRCEVN-----  701
             C N  GSF C+C  G +L  +   C+D    SL       G C   I   +C  N     
Sbjct  1174  CVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQA  1233

Query  702   ---INGATLKSECCATLGAAWGSPCERCE--LDTACSRGFARV-NGVTCEDVNECDVFPG  755
                  G T   EC   +     + C   E   + +CS G+A + +G +C D++EC+  P 
Sbjct  1234  TPDRQGCTDIDEC-MIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPD  1292

Query  756   VCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIR---------------------MEQC  794
             +C  G+C N  G + C C +G       + C+D+                      +  C
Sbjct  1293  ICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHC  1352

Query  795   YLTW----------DEDEC------------IRSVPGKFRMDACCCAVGAAWGS------  826
              L +          D DEC              ++PG F+     C+    W        
Sbjct  1353  QLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFK-----CSCREGWIGNGIKCI  1407

Query  827   DCEECPKPDTK-EYEALCPRGPGFSNR---GDILTGRPFY-KDINECKVFPGMCMNGKCR  881
             D +EC     +    A C   PG S R    +  TG  F   D++EC     +C NG+C 
Sbjct  1408  DLDECSNGTHQCSINAQCVNTPG-SYRCACSEGFTGDGFTCSDVDECAENINLCENGQCL  1466

Query  882   NTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGF  941
             N  G+++C+C  GFT   + R+C DIDEC    ++C  GTC N PG F C C DGYE   
Sbjct  1467  NVPGAYRCECEMGFTPASDSRSCQDIDECSFQ-NICVFGTCNNLPGMFHCICDDGYELD-  1524

Query  942   MMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECID--VNECSL--  997
                 NC DIDEC  +P+ C  G CVNT G ++C+CP   +L+P+   C+D  V  C L  
Sbjct  1525  RTGGNCTDIDECA-DPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKF  1583

Query  998   --------------------SDSLCRNGKC----------VNMVGTYQ-CSCNSGYQATP  1026
                                 S   C  GK           VN    Y  C    G++  P
Sbjct  1584  GPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNP  1643

Query  1027  DRRSCTDIDECMIMNGGCHT-HCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDIC  1085
                   DIDEC  + G C   +C N+ GS++C C  GY L  D R C DIDEC ++P +C
Sbjct  1644  ITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDECFAHPGVC  1703

Query  1086  DGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQL  1145
               G C N  G Y C+C   +M       C+D+ +            C  +     C  +L
Sbjct  1704  GPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRK----------SFCYRSYNGTTCENEL  1753

Query  1146  GYSVKKGTTGCT-DVDE-----CEI--GAHNCDMHASCVNVPGSFKCSCREGWVGNGIKC  1197
              ++V K    CT +V +     CE        D    C N+PG F      G      K 
Sbjct  1754  PFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPG-FTFDIHTG------KA  1806

Query  1198  IDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGF--TCSDVDECAENVHLCE-NG  1254
             +D+DEC      C+ N  C+N  GS+ C C  GF+ +     C D+DEC+   +LC+ N 
Sbjct  1807  VDIDECKEIPGICA-NGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNA  1865

Query  1255  QCLNVPGAYRCECEMGFTPASDSKSCQDINEC-SFQNICVFGTCNNLPGMFHCICDDGYE  1313
              C+N PG+YRCEC  GF   S + +C D NEC    N+C  G C +L G + CIC +G++
Sbjct  1866  DCINSPGSYRCECAAGFK-LSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFK  1924

Query  1314  LDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLK  1373
               +    C DVDEC +   C NG C NT G Y C C P F+L      C+D  +  C   
Sbjct  1925  ASQDQTMCMDVDEC-ERHPCGNGTCKNTVGSYNCLCYPGFELTHNN-DCLD--IDECSSF  1980

Query  1374  YGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPN  1433
             +G        C  EIG                              +  LC   EG+   
Sbjct  1981  FGQVCRNG-RCFNEIG-----------------------------SFKCLC--NEGYELT  2008

Query  1434  PITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGV  1493
             P      D +EC  LPG C  G C N  GSF+C CP GY +  E   C DI+EC   P +
Sbjct  2009  PDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSEN--CIDINECDEDPNI  2066

Query  1494  CGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMC  1553
             C  G+C NT G + C+CPP ++  + G  C D R+SFC+ ++    C     FN TK  C
Sbjct  2067  CLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKC  2126

Query  1554  CCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICANG  1613
             CC+   G+ W  PCE CP      F+++C    G    +H  +  D++EC E PGIC+NG
Sbjct  2127  CCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTRE-DVNECLESPGICSNG  2185

Query  1614  VCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGF  1673
              CIN  GSFRCECP G++ +   + C D DECS G N C  N  C N  GS+ C C  GF
Sbjct  2186  QCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIG-NPCG-NGTCTNVIGSFECNCNEGF  2243

Query  1674  KLSPNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECER--  1731
             +  P   C D NEC + P +C+   C++  GSY+C C  G+   +DQ MC D+DEC    
Sbjct  2244  EPGPMMNCEDINECAQNPLLCAF-RCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGL  2302

Query  1732  HPCGNG--TCKNTVGSYNCLCYPGFELTHNND-CMDIDEC--------------------  1768
             H C +    CKN +G++ C+C PG     + + C+D +EC                    
Sbjct  2303  HDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYR  2362

Query  1769  --------SSFFGQVC---RNGRCFNEI--------------------------------  1785
                     SS  G  C   R G CF E+                                
Sbjct  2363  CECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQC  2422

Query  1786  --------GSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPG  1837
                       +K +C  G   T DG+   D +EC  +P  C+ G C N  GSFRC C  G
Sbjct  2423  ELCPLPGTAQYKKICPHGPGYTTDGR---DIDECKVMPNLCTNGQCINTMGSFRCFCKVG  2479

Query  1838  Y--EVKSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTR----  1891
             Y  ++   SCID++EC++ P  C +  C NT G +QC CP G+VL ++G+ C D      
Sbjct  2480  YTTDISGTSCIDLDECSQSPKPCNY-ICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQT  2538

Query  1892  -----QSFCFTNFENGKCSVPKAFNTTKAKCC----CSKMPGE-GWGDPCELCPKEEEVA  1941
                  Q  C        C  P  F      C     C   P   G    C+  P     +
Sbjct  2539  KQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPG----S  2594

Query  1942  FQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVH  2001
             F   C  G  ++       EDV+EC +    C +G C N  G +RC CP GY   Y    
Sbjct  2595  FSCECQRGF-SLDATGLNCEDVDEC-DGNHRCQHG-CQNILGGYRCGCPQGYIQHYQWNQ  2651

Query  2002  CIDTDECSIGNPCGNGTCTNVIGSFECNCHEGF  2034
             C+D +ECS  N CG+ +C N +GS++C C  GF
Sbjct  2652  CVDENECSNPNACGSASCYNTLGSYKCACPSGF  2684


 Score = 730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 630/1975 (32%), Positives = 865/1975 (44%), Gaps = 405/1975 (21%)

Query  286   IDICKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNG-DCTDVDECTS-NPCSNGDCVNT  343
             ID C  +  LC NGRC+ T  S++C CN G++  ++G +C D DECT+ N C NG C+N 
Sbjct  576   IDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINE  635

Query  344   PGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDG  403
              GS+ C C  GF   P  + C D+DEC   G+ C NG C+N++GSF+C C  G  +  DG
Sbjct  636   DGSFKCICKPGFVLAPNGRYCTDVDECQTPGI-CMNGHCINSEGSFRCDCPPGLAVGMDG  694

Query  404   KNCVD-HDECTTTNMCLNGMCI------------------------------NEDGSFKC  432
             + CVD H   T       G+C+                                   F  
Sbjct  695   RVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHG  754

Query  433   ICKPGFVLAPNGRYCTDIDECQTS-GICMNGHCINTEGSFRCECPPGLAVGVDGRVCVDT  491
             +C  G  +  +GR   DI+EC     IC NG C N  GS+RC C  G      GR C+D 
Sbjct  755   LCSSGVGITVDGR---DINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDI  811

Query  492   HM----RSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGLC  547
                   R  C  G+      R  PG+ +    C   P Y F      C            
Sbjct  812   DECLVNRLLCDNGL-----CRNTPGSYS----CTCPPGYVFRTETETC------------  850

Query  548   SSGIGITVDGRDINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDID----  603
                        DINEC  +P  C NG C N  GS+ C C+ G +   +G  C+D      
Sbjct  851   ----------EDINECESNP--CVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTC  898

Query  604   ---------ECSVNRLLCDNGLCRNTPGSY---------SCTCPKGYVFSTETDTCEDIN  645
                      E ++N     +  C     ++            CP+G +   +  TCED+N
Sbjct  899   WLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRG-LARIKGVTCEDVN  957

Query  646   ECESSP--CVNGACRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVNIN  703
             ECE  P  C NG C N+ GSF+CEC  G  LD TG +C+D     C+L   +  C   + 
Sbjct  958   ECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVP  1017

Query  704   GATLKSECCATLGAAWGSPCERC------ELDTACSRG--FARVNGVTC-----EDVNEC  750
             G      CC  +GAAWG+ CE C      E +T C RG  FA    V       +D+NEC
Sbjct  1018  GKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINEC  1077

Query  751   DVFPGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWD-----------  799
               FPG+C  G+C N+ GSF C C  G  LD   R C DI  ++C ++ D           
Sbjct  1078  KAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDI--DECRISPDLCGSGICVNTP  1135

Query  800   ---EDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKP--------DTKEYEALCPRGPG  848
                E EC       F M   C  +      +CE  P              ++  CP G  
Sbjct  1136  GSFECECFEGYESGFMMMKNCMDI-----DECERNPLLCRGGTCVNTEGSFQCDCPLGHE  1190

Query  849   FS-NRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDI  907
              S +R D +       DINEC +   +C NGKC N IG+++C CN G+    + + CTDI
Sbjct  1191  LSPSREDCV-------DINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDI  1243

Query  908   DECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVN  967
             DEC I    C +  C N+ GS+EC C +GY +     ++C DIDECE NP +C GG C N
Sbjct  1244  DECMIMNGGCDT-QCTNSEGSYECSCSEGY-ALMPDGRSCADIDECENNPDICDGGQCTN  1301

Query  968   TEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPD  1027
               G ++C C  G   S   + CIDVNEC L+ ++C  G+C N  G++ C C  GY     
Sbjct  1302  IPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKG  1361

Query  1028  RRSCTDIDECMIMNGGC--HTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDIC  1085
                CTD+DEC I    C  H  C N  GS++CSC +G+  + +   C D+DEC +    C
Sbjct  1362  TTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGW--IGNGIKCIDLDECSNGTHQC  1419

Query  1086  D-GGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQ  1144
                 QC N PG YRC C +GF    D  TC DV+EC  N N+C  G+C N  G++ C C+
Sbjct  1420  SINAQCVNTPGSYRCACSEGFTG--DGFTCSDVDECAENINLCENGQCLNVPGAYRCECE  1477

Query  1145  LGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGN--GIKCIDLDE  1202
             +G++    +  C D+DEC     N  +  +C N+PG F C C +G+  +  G  C D+DE
Sbjct  1478  MGFTPASDSRSCQDIDECSF--QNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDE  1535

Query  1203  CSNGTHQCSVNAQCVNSPGSYLCACVEGF----TGDGFTCSDVDECAEN-----------  1247
             C++  +   VN  CVN+PG Y C C   F    TG G   + V  C              
Sbjct  1536  CADPIN--CVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSC  1593

Query  1248  -----VHLCENGQCLNVPGAYRCECEM-----------------GFTPASDSKSCQDINE  1285
                  V +  +  C ++  A+   CE                  GF P   +   +DI+E
Sbjct  1594  NTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDE  1653

Query  1286  CS-FQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDEC-ADPINCVNGLCVNTPG  1343
             C     +C  G C N  G F C C  GY L      C D+DEC A P  C  G C NT G
Sbjct  1654  CQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDECFAHPGVCGPGTCYNTLG  1713

Query  1344  RYECNCPPDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCS--L  1401
              Y C CPP++     G  C+D R   CY  Y        +C  E+   V++  CCC+  +
Sbjct  1714  NYTCICPPEYMQVNGGHNCMDMRKSFCYRSYN-----GTTCENELPFNVTKRMCCCTYNV  1768

Query  1402  GKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTF  1461
             GKAW  PCE CP   + ++ T+C    GF                               
Sbjct  1769  GKAWNKPCEPCPTPGTADFKTICGNIPGFT------------------------------  1798

Query  1462  GSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGH  1521
                             T    DIDEC   PG+C  G C N +G++ C CP  +   +   
Sbjct  1799  ------------FDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLL  1846

Query  1522  NCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNI  1581
              C D+ +       NG         N+ +R   C                +PG+      
Sbjct  1847  VCEDIDEC-----SNGD--------NLCQRNADCIN--------------SPGSYR----  1875

Query  1582  CGNIPGFTFDIHSGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCED  1641
             C    GF     +G  VD +EC EIP +C++G+C++  GS++C C  GF  +    +C D
Sbjct  1876  CECAAGFKLS-PNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMD  1934

Query  1642  IDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEI-PNVCSHGLCV  1700
             +DEC    + C  N  C N+ GSY C C  GF+L+ N  C+D +EC      VC +G C 
Sbjct  1935  VDECER--HPCG-NGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCF  1991

Query  1701  DMQGSYKCICHNGFKASQDQTMCMDVDECERHP--CGNGTCKNTVGSYNCLCYPGFELTH  1758
             +  GS+KC+C+ G++ + D   C+D +EC   P  C  GTC+N  GS+ C+C PG+E+  
Sbjct  1992  NEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKS  2051

Query  1759  NNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNE--------  1810
              N C+DI+EC      +C  G C N  G F+CLC  G+ L+ +G+ C DT +        
Sbjct  2052  EN-CIDINECDED-PNICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNFE  2109

Query  1811  ------------------CVALPGSCSPGTCQ----NLEGSFRCICPPGYEV---KSESC  1845
                               C  +PG      C+    + E +F+ +CP G+       ++ 
Sbjct  2110  NGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTR  2169

Query  1846  IDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCS  1905
              D+NEC E P IC  G C NT G F+C CP G+ L   G RC DT +        NG C+
Sbjct  2170  EDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCT  2229

Query  1906  VPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNE  1965
                                               V     C    G  PG     ED+NE
Sbjct  2230  ---------------------------------NVIGSFECNCNEGFEPGPMMNCEDINE  2256

Query  1966  CLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIG--------------  2011
             C ++P +C+   C+NT GS+ C CP+GY L      C D DEC+ G              
Sbjct  2257  CAQNPLLCAF-RCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNL  2315

Query  2012  -------------------------------NPCGNGTCTNVIGSFECNCHEGFE  2035
                                              C NG C N+IGS+ C C+EGF+
Sbjct  2316  IGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQ  2370


 Score = 668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/2219 (30%), Positives = 925/2219 (42%), Gaps = 390/2219 (18%)

Query  7     CFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQ  66
             C+  +   +C     G V     CCA     +G PC+ CPA+                  
Sbjct  706   CYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNS----------------  749

Query  67    DVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICEGSECS  126
                      G+C  G  I   G                    DI+EC++ P IC    C 
Sbjct  750   -----AEFHGLCSSGVGITVDGR-------------------DINECALDPDICANGICE  785

Query  127   NTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIV---NGRCAQELPGRFTKRQCCCES  183
             N  GSY C C  GY     G  CID     C  N +   NG C +  PG ++   C C  
Sbjct  786   NLRGSYRCNCNSGYEPDASGRNCID--IDECLVNRLLCDNGLC-RNTPGSYS---CTCPP  839

Query  184   GRCWAMGSVPEMCPVRGSDEYRRLCVDGAPAGGG-------SRGGGTGGNGFL--PSGNG  234
             G  +   +  E C      E    CV+GA            S G      G +   S  G
Sbjct  840   G--YVFRTETETCEDINECE-SNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKG  896

Query  235   NGHGHGPRGAGFIPIPGSNGFSPGVGGAGVGTGSSTGNGPIIT----GLTILN----QTI  286
                 +       + I G+   S      G   GS      + T    GL  +     + +
Sbjct  897   TCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDV  956

Query  287   DICKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNGD-CTDV-----------DECTSNP  334
             + C+  P +C NGRC+ +  S+ CEC  G   D  G  C D+           DEC    
Sbjct  957   NECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPV  1016

Query  335   ----------CSNGDCVNT-------PGSY----YCKCHAGFQR----TPTKQACIDIDE  369
                       C+ G    T       PG+      C   AGF         +    DI+E
Sbjct  1017  PGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINE  1076

Query  370   CIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTT-NMCLNGMCINEDG  428
             C     +C  G+C NT GSF+C CN+GF L  + +NC D DEC  + ++C +G+C+N  G
Sbjct  1077  CKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPG  1136

Query  429   SFKCIC----KPGFVLAPNGRYCTDIDECQTSGI-CMNGHCINTEGSFRCECPPGLAVGV  483
             SF+C C    + GF++  N   C DIDEC+ + + C  G C+NTEGSF+C+CP G  +  
Sbjct  1137  SFECECFEGYESGFMMMKN---CMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSP  1193

Query  484   DGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEF  543
                 CVD +  S      + G CV      +   +C C NP Y           + + + 
Sbjct  1194  SREDCVDINECSLSDNLCRNGKCVN----MIGTYQCSC-NPGY-----------QATPDR  1237

Query  544   HGLCSSGIGITVDGRDINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDID  603
              G             DI+EC +    C    C N  GSY C+C+ GY   P GR+C DID
Sbjct  1238  QGC-----------TDIDECMIMNGGCDTQ-CTNSEGSYECSCSEGYALMPDGRSCADID  1285

Query  604   ECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINECE--SSPCVNGACRNNL  661
             EC  N  +CD G C N PG Y C C  G++ S +  TC D+NEC+  S+ C+ G C N  
Sbjct  1286  ECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTK  1345

Query  662   GSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGS  721
             GSF C C  G  +      C D              CE+  +   + + C    G+    
Sbjct  1346  GSFICHCQLGYSVKKGTTGCTDV-----------DECEIGAHNCDMHASCLNIPGS----  1390

Query  722   PCERCELDTACSRGFARVNGVTCEDVNECDVFPGVCP-NGRCINSRGSFHCECPEGLTLD  780
                      +C  G+   NG+ C D++EC      C  N +C+N+ GS+ C C EG T  
Sbjct  1391  ------FKCSCREGWIG-NGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFT--  1441

Query  781   GTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYE  840
             G G  C D+      +   E+    +VPG +R   C C +G    SD   C   D   ++
Sbjct  1442  GDGFTCSDVDECAENINLCENGQCLNVPGAYR---CECEMGFTPASDSRSCQDIDECSFQ  1498

Query  841   ALCPRG-----PGF-----SNRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCK  890
              +C  G     PG       +  ++        DI+EC   P  C+NG C NT G ++C 
Sbjct  1499  NICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDEC-ADPINCVNGLCVNTPGRYECN  1557

Query  891   CNSGFTLDMEERNCTD--IDECWISPDLCGSGT---------------------------  921
             C   F L+     C D  +  C++     G G+                           
Sbjct  1558  CPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNP  1617

Query  922   CVNTPGSFECECFDGYESGFMMMKNCM-----DIDECERNPLLCRGGTCVNTEGSFQCDC  976
             C   P     E +     G     N +     DIDEC+  P LC+GG C+NT GSFQC+C
Sbjct  1618  CETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCEC  1677

Query  977   PLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDE  1036
             P G+ LS     C D++EC     +C  G C N +G Y C C   Y       +C D+ +
Sbjct  1678  PQGYYLSEDTRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRK  1737

Query  1037  CMIMNGGCHTHCTNS-------------------------------EGSYECSCSDGYAL  1065
                      T C N                                   ++  C +    
Sbjct  1738  SFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGF  1797

Query  1066  MPDVRT--CADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLN  1123
               D+ T    DIDEC+  P IC  G C N  G +RC C  GF  +  +  C D++EC   
Sbjct  1798  TFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNG  1857

Query  1124  SNICMF-GECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSF  1182
              N+C    +C N+ GS+ C C  G+ +      C D +EC +   N   H  CV++ GS+
Sbjct  1858  DNLCQRNADCINSPGSYRCECAAGFKLSP-NGACVDRNEC-LEIPNVCSHGLCVDLQGSY  1915

Query  1183  KCSCREGWVG--NGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGF-TGDGFTCS  1239
             +C C  G+    +   C+D+DEC    H C  N  C N+ GSY C C  GF       C 
Sbjct  1916  QCICHNGFKASQDQTMCMDVDECER--HPCG-NGTCKNTVGSYNCLCYPGFELTHNNDCL  1972

Query  1240  DVDECAENV-HLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINEC-SFQNICVFGTC  1297
             D+DEC+     +C NG+C N  G+++C C  G+    D K+C D NEC +    C  GTC
Sbjct  1973  DIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTC  2032

Query  1298  NNLPGMFHCICDDGYELDRTGGNCTDVDEC-ADPINCVNGLCVNTPGRYECNCPPDFQLN  1356
              NL G F CIC  GYE+     NC D++EC  DP  C+ G C NTPG ++C CPP F L+
Sbjct  2033  QNLEGSFRCICPPGYEVKSE--NCIDINECDEDPNICLFGSCTNTPGGFQCLCPPGFVLS  2090

Query  1357  PTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSL--GKAWGNPCETCPP  1414
               G  C D R   C+  +      +  C+       +++ CCCS   G+ WG+PCE CP 
Sbjct  2091  DNGRRCFDTRQSFCFTNFE-----NGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPK  2145

Query  1415  VNSTEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYL  1474
              +   +  LCP G G  P+ +    ED++EC E PG+C  G CINT GSF+CECP GY L
Sbjct  2146  DDEVAFQDLCPYGHGTVPS-LHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNL  2204

Query  1475  SEETRICEDIDEC-VAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYR  1533
                   C D DEC + +P  CG GTC N +G++ C C  E  +     NC D+       
Sbjct  2205  DYTGVRCVDTDECSIGNP--CGNGTCTNVIGSFECNCN-EGFEPGPMMNCEDI-------  2254

Query  1534  SYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIH  1593
                     NE   N       C +     +      CP               G+     
Sbjct  2255  --------NECAQNPLL----CAFRCMNTFGSYECTCPI--------------GYALRED  2288

Query  1594  SGKAVDIDECKEIPGICANG--VCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNL  1651
                  D+DEC E    C +   +C N IG+F C CP G +       C D +EC     +
Sbjct  2289  QKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGI  2348

Query  1652  CQRNADCINSPGSYRCECAAGFKLSPNGA-CVDRNECLEIPNVC---------SHGLCVD  1701
             C+ N  C+N  GSYRCEC  GF+ S +G  C+D  + L    V          S  L   
Sbjct  2349  CE-NGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTK  2407

Query  1702  MQ---------------------GSYKCICHNGFKASQDQTMCMDVDECERHP--CGNGT  1738
              +                       YK IC +G   + D     D+DEC+  P  C NG 
Sbjct  2408  SECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDG---RDIDECKVMPNLCTNGQ  2464

Query  1739  CKNTVGSYNCLCYPGFEL-THNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYE  1797
             C NT+GS+ C C  G+        C+D+DECS        N  C N  GS++C C  GY 
Sbjct  2465  CINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPC--NYICKNTEGSYQCSCPRGYV  2522

Query  1798  LTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSESCIDINECNEDPNI  1857
             L  DGK C D +EC     +C    C N  G F C CPPG+     +CID NEC   P++
Sbjct  2523  LQEDGKTCKDLDECQTKQHNCQ-FLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSL  2581

Query  1858  C-LFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAK  1916
             C   G C NTPG F C C  GF L   G  C D                V +     + +
Sbjct  2582  CGAKGICQNTPGSFSCECQRGFSLDATGLNCED----------------VDECDGNHRCQ  2625

Query  1917  CCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNG  1976
               C  + G                 ++  CP G+      +    D NEC  +P  C + 
Sbjct  2626  HGCQNILG----------------GYRCGCPQGYIQHYQWNQCV-DENEC-SNPNACGSA  2667

Query  1977  HCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIG-NPCGNGTCTNVIGSFECNCHEGF  2034
              C NT GS++C CP G++ D     C D +ECS   NPC  G C+N  G + C C  G+
Sbjct  2668  SCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCNYG-CSNTEGGYLCGCPPGY  2725


 Score = 343 bits (881),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 324/1049 (31%), Positives = 429/1049 (41%), Gaps = 250/1049 (24%)

Query  1183  KCSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDG-------  1235
              C C++G++G          C NG   C    +C+   G   CACV GFTG         
Sbjct  163   HCQCQKGYIGTYCG---QPVCENG---CQNGGRCI---GPNRCACVYGFTGPQCERDYRT  213

Query  1236  ---FTCSDVDECAENVH--LCENGQCLNVPG-AYRCECEM----------GFTPASDSKS  1279
                FT  +   C   +   +C    C    G A+   CEM          GF P   + +
Sbjct  214   GPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGA  273

Query  1280  CQDINEC-SFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDECA-DPINCVNGL  1337
             CQD++EC +   IC  G C N  G F C C  G++   T   C D+DEC+  P  C  G 
Sbjct  274   CQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGICETGE  333

Query  1338  CVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSC  1397
             C NT G Y C CP  +  +  G  C+D R G C+      G  +  C  E+   +++  C
Sbjct  334   CSNTVGSYFCVCPRGYVTSTDGSRCIDQRTGMCF-----SGLVNGRCAQELPGRMTKMQC  388

Query  1398  CCSLGKAW--GNPCETCPPVNSTEYNTLC-------------------------------  1424
             CC  G+ W  G   E CP   S EY  LC                               
Sbjct  389   CCEPGRCWGIGTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNG  448

Query  1425  -------------PGGEGFRPNP----------------ITIILEDIDECQELPGLCQGG  1455
                          PGG GF P                  +TI+ + ID C+    LC  G
Sbjct  449   NGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDICKHHANLCLNG  508

Query  1456  NCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYM  1515
              CI T  S++CEC  GY   +    C D+DEC ++P  C  G C NT G+Y C C   + 
Sbjct  509   RCIPTVSSYRCECNMGYK-QDANGDCIDVDECTSNP--CTNGDCVNTPGSYYCKCHAGFQ  565

Query  1516  QVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGT  1575
             +      C+D+ +       NG  C+N                 G+  N           
Sbjct  566   RTPTKQACIDIDECI----QNGVLCKN-----------------GRCVNT---------D  595

Query  1576  AEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDL  1635
               F+ IC    GF         VD DEC     +C NG+CIN+ GSF+C C  GF     
Sbjct  596   GSFQCICN--AGFELTTDGKNCVDHDECTTT-NMCLNGMCINEDGSFKCICKPGFVLAPN  652

Query  1636  LLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNG-ACVD-----------  1683
                C D+DEC     +C  N  CINS GS+RC+C  G  +  +G  CVD           
Sbjct  653   GRYCTDVDECQT-PGICM-NGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGI  710

Query  1684  --------------RNEC---------------------LEIPNVCSHGLCVDMQG----  1704
                           ++EC                      E   +CS G+ + + G    
Sbjct  711   KKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDIN  770

Query  1705  -------------------SYKCICHNGFKASQDQTMCMDVDEC--ERHPCGNGTCKNTV  1743
                                SY+C C++G++       C+D+DEC   R  C NG C+NT 
Sbjct  771   ECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTP  830

Query  1744  GSYNCLCYPGFEL-THNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDG  1802
             GSY+C C PG+   T    C DI+EC S     C NG C N +GSF C C+ G +L+  G
Sbjct  831   GSYSCTCPPGYVFRTETETCEDINECES---NPCVNGACRNNLGSFNCECSPGSKLSSTG  887

Query  1803  KNCIDT------------------------NECVALPGSCSPGTCQNLEGSFRCICPPGY  1838
               CID+                        +EC A  G+     C+  E      CP G 
Sbjct  888   LICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCE--LDTACPRGL  945

Query  1839  -EVKSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFT  1897
               +K  +C D+NEC   P +C  G C N+ G F C CP G  L   GR C D R   C+ 
Sbjct  946   ARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYL  1005

Query  1898  NFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGID  1957
              ++  +C  P         CCC+   G  WG  CE CPK     ++ LCP G G     D
Sbjct  1006  KWDEDECIHPVPGKFRMDACCCAV--GAAWGTECEECPKPGTKEYETLCPRGAGFANRGD  1063

Query  1958  DTR-----EDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIG-  2011
                     +D+NEC   PG+C+ G C NT GSF+C C  G+ LD    +C D DEC I  
Sbjct  1064  VLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISP  1123

Query  2012  NPCGNGTCTNVIGSFECNCHEGFEPGPMM  2040
             + CG+G C N  GSFEC C EG+E G MM
Sbjct  1124  DLCGSGICVNTPGSFECECFEGYESGFMM  1152


 Score = 102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 94/334 (28%), Positives = 132/334 (40%), Gaps = 68/334 (20%)

Query  390  QCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTD  449
             C C++G   +T G   +   +C+    C+NG    +D    C C+ G++    G YC  
Sbjct  129  MCTCSSGQISSTCGSKSIQ--QCSV--RCMNGGTCADD---HCQCQKGYI----GTYCGQ  177

Query  450  I---DECQTSGICMNGHCINTEGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGAC  506
                + CQ  G C+        G  RC C      G  G  C   +    C+  +    C
Sbjct  178  PVCENGCQNGGRCI--------GPNRCAC----VYGFTGPQCERDYRTGPCFTQVNNQMC  225

Query  507  VRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGLCSSGIGITVDGRDINECALD  566
                 G V     CCA     +G PC  CPA+      G   +    T   +D++EC   
Sbjct  226  QGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPN--IRTGACQDVDECQAI  283

Query  567  PDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSC  626
            P IC  G C N  GS+ C C +G++   + + C DIDECS+   +C+ G C NT GSY C
Sbjct  284  PGICQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFC  343

Query  627  TCPKGYVFSTETDTCEDINECESSPCVNGACRNNLGSFNCECSPGSKLDSTGLICIDSLK  686
             CP+GYV ST+                                        G  CID   
Sbjct  344  VCPRGYVTSTD----------------------------------------GSRCIDQRT  363

Query  687  GTCWLNIQDSRCEVNINGATLKSECCATLGAAWG  720
            G C+  + + RC   + G   K +CC   G  WG
Sbjct  364  GMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWG  397


 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 93/359 (26%), Positives = 127/359 (35%), Gaps = 91/359 (25%)

Query  1648  GDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLE---------IPNVCSHGL  1698
             GD  C R   C  S G     C +      +  C++   C +         I   C   +
Sbjct  120   GDGFCSRPNMCTCSSGQISSTCGSKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPV  179

Query  1699  CVDM-------QGSYKCICHNGFKASQ--------------DQTMCMDVDECERHPCGNG  1737
             C +         G  +C C  GF   Q              +  MC    +     C   
Sbjct  180   CENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQ--GQLTGIVCTKT  237

Query  1738  TCKNTVG-----------SYNCLCYPGF-ELTHNNDCMDIDECSSFFGQVCRNGRCFNEI  1785
              C  T+G           +    C  GF        C D+DEC +  G +C+ G C N +
Sbjct  238   LCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPG-ICQGGNCINTV  296

Query  1786  GSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSESC  1845
             GSF+C C  G++ +   + C D +EC  +PG C  G C N  GS+ C+CP GY       
Sbjct  297   GSFECRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGY-------  349

Query  1846  IDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCS  1905
                                              V S +G RC D R   CF+   NG+C+
Sbjct  350   ---------------------------------VTSTDGSRCIDQRTGMCFSGLVNGRCA  376

Query  1906  VPKAFNTTKAKCCCSKMPGEGWGDPC--ELCPKEEEVAFQDLCPYG--HGTIPGIDDTR  1960
                    TK +CCC   PG  WG     E CP      ++ LC  G   G IPG   +R
Sbjct  377   QELPGRMTKMQCCCE--PGRCWGIGTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSR  433


> sp|Q75N90|FBN3_HUMAN Fibrillin-3 OS=Homo sapiens GN=FBN3 PE=2 
SV=3
Length=2809

 Score = 2887 bits (7483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1385/2047 (68%), Positives = 1656/2047 (81%), Gaps = 66/2047 (3%)

Query  1     DYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNI  60
             DYRTGPCF QV  + CQ QLTG+VCTK LCCAT+GRAWG PCE+CPAQP PCRRGFIPNI
Sbjct  181   DYRTGPCFGQVGPEGCQHQLTGLVCTKALCCATVGRAWGLPCELCPAQPHPCRRGFIPNI  240

Query  61    RTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGIC  120
              TGA                                          C D+DEC  +PG+C
Sbjct  241   HTGA------------------------------------------CQDVDECQAVPGLC  258

Query  121   EGSECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQELPGRFTKRQCC  180
             +G  C N VGS+ C CP G+  S   + C D RA  CFS +  GRCA +L G +T+RQCC
Sbjct  259   QGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFGGRCAGDLAGHYTRRQCC  318

Query  181   CESGRCWAMGSVPEMCPVRGSDEYRRLCVDGAPAGGGSRGGGTGGNGFLPSGNGNGHGHG  240
             C+ GRCWA G VPE+CP RGS+E+++LC    P   G  G   G  GF  +G G   G  
Sbjct  319   CDRGRCWAAGPVPELCPPRGSNEFQQLCAQRLPLLPGHPGLFPGLLGFGSNGMGPPLGPA  378

Query  241   ---PRGAGFIPIPGSNGFSPGVGGAGVGTGSSTGNGPIITGLTILNQTIDICKHHPDLCL  297
                P G+    IP     S G G + +GT +             LNQTIDIC+H  +LCL
Sbjct  379   RLNPHGSDARGIP-----SLGPGNSNIGTAT-------------LNQTIDICRHFTNLCL  420

Query  298   NGRCIPTLSSYRCECNMGYKQDSNGDCTDVDECTSNPCSNGDCVNTPGSYYCKCHAGFQR  357
             NGRC+PT SSYRCECN+GY QD  G+C DVDECTS+PC +GDCVN PG+Y+C+C+ GFQ 
Sbjct  421   NGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTSSPCHHGDCVNIPGTYHCRCYPGFQA  480

Query  358   TPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNM  417
             TPT+QAC+D+DECI +G LC  GRCVNT+GSFQC+CNAGFEL+ DGKNCVDH+EC T+ M
Sbjct  481   TPTRQACVDVDECIVSGGLCHLGRCVNTEGSFQCVCNAGFELSPDGKNCVDHNECATSTM  540

Query  418   CLNGMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCECPP  477
             C+NG+C+NEDGSF C+CKPGF+LAP G YC DIDECQT GIC+NGHC NTEGSFRC+C  
Sbjct  541   CVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICVNGHCTNTEGSFRCQCLG  600

Query  478   GLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPA  537
             GLAVG DGRVCVDTH+RSTCYG I+KG+C RPFPG VTKSECCCANPD+GFGEPC  CPA
Sbjct  601   GLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPA  660

Query  538   KNSAEFHGLCSSGIGITVDGRDINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGR  597
             K+SAEF  LCSSG+GIT DGRDINECALDP++C+NG+CENLRGSYRC CN GYE   SG+
Sbjct  661   KDSAEFQALCSSGLGITTDGRDINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGK  720

Query  598   NCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINECESSPCVNGAC  657
             +C D+DEC++N LLCDNG C+N+PGSYSC+CP G+ F  +T+ C+D++EC SSPCV+G C
Sbjct  721   DCTDVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSPCVSGVC  780

Query  658   RNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGA  717
             RN  GS+ C+C PGS+LD +G  C+DS KGTCWL IQ+SRCEVN+ GA+L+SECCATLGA
Sbjct  781   RNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGA  840

Query  718   AWGSPCERCELDTACSRGFARVNGVTCEDVNECDVFPGVCPNGRCINSRGSFHCECPEGL  777
             AWGSPCERCE+D AC+RGFAR+ GVTC+DVNEC+ FPGVCPNGRC+N+ GSF CECPEGL
Sbjct  841   AWGSPCERCEIDPACARGFARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGL  900

Query  778   TLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTK  837
              LD +GR+C+D+R+E C+L WDEDEC  ++PGK+RMD CCC++GA WG +CE CP P++ 
Sbjct  901   MLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESL  960

Query  838   EYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTL  897
             E+ +LCPRG GF++R D L+GRPFYKD+NECKVFPG+C +G CRNT+GSF C C  GF L
Sbjct  961   EFASLCPRGLGFASR-DFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFAL  1019

Query  898   DMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNP  957
             D +ERNCTDIDEC ISPDLCG GTCVNTPGSFECECF GYESGFM+MKNCMD+DEC R+P
Sbjct  1020  DAQERNCTDIDECRISPDLCGQGTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDP  1079

Query  958   LLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCS  1017
             LLCRGGTC NT+GS++C CP GHEL+     C D++ECSLSD LC +G+CVN++G +QCS
Sbjct  1080  LLCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLCPHGQCVNVIGAFQCS  1139

Query  1018  CNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDE  1077
             C++G+Q+TPDR+ C DI+EC + NGGC  HC N+EGSY CSC  GY+LMPD R CAD+DE
Sbjct  1140  CHAGFQSTPDRQGCVDINECRVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDE  1199

Query  1078  CESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKG  1137
             CE NP +CD G CTN+PG +RCLCYDGFMA+ DM+TC+DV+ECDLN +IC+ G+CENTKG
Sbjct  1200  CEENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLNPHICLHGDCENTKG  1259

Query  1138  SFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIKC  1197
             SF+CHCQLGY V+KG TGC+DVDECE+G HNCD HASC+N+PGSF C C  GWVG+G +C
Sbjct  1260  SFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFEC  1319

Query  1198  IDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECAENVHLCENGQCL  1257
              DLDEC +  H+CS    C+N PGSY C C +GF GDGF C D DECAENV LC+NGQCL
Sbjct  1320  HDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCL  1379

Query  1258  NVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYELDRT  1317
             N PG YRCECEMGF P  D ++CQD++EC+  N+C FG+C NLPGMF CIC+ GYELDR 
Sbjct  1380  NAPGGYRCECEMGFDPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRG  1439

Query  1318  GGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKYGPR  1377
             GGNCTD++ECADP+NC+NG+C+NTPG Y C+CP DF+LNP+GVGCVD R GNC+L+   R
Sbjct  1440  GGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDR  1499

Query  1378  GDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNPITI  1437
             GD  +SC+ EIGVGV+R+SCCCSLG+AWGNPCE CP  N+TEY TLCPGGEGF+PN IT+
Sbjct  1500  GDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITV  1559

Query  1438  ILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPG  1497
             ILEDIDECQELPGLCQGG+C+NTFGSFQCECP GY+LSE TRICEDIDEC  H G+CGPG
Sbjct  1560  ILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPG  1619

Query  1498  TCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTY  1557
             TCYNTLGNYTC+CP EY+QVNGG+NCMDMRKS C+R YNGT C+NEL FNVT++MCCC+Y
Sbjct  1620  TCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGT-CQNELAFNVTRKMCCCSY  1678

Query  1558  NVGKAWNKPCEPCPTPGTAEFKNICGN-IPGFTFDIHSGKAVDIDECKEIPGICANGVCI  1616
             N+G+AWN+PCE CPTP + +++ +CGN  PGF  DIH+GK +DIDEC EIP ICANG+CI
Sbjct  1679  NIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICI  1738

Query  1617  NQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLS  1676
             NQIGSFRCECP GF+YN +LL CED+DEC + ++ CQ+NADCIN PGSYRC+C  G+KLS
Sbjct  1739  NQIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLS  1798

Query  1677  PNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPCGN  1736
             P GACV RNEC EIPNVCSHG C+D +GSY C+CH GF+AS DQT+CMD+DEC+R PCGN
Sbjct  1799  PGGACVGRNECREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQPCGN  1858

Query  1737  GTCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGY  1796
             GTCKN +GSYNCLC+PGF +THN DC+D DEC++  GQVCR G C N  GSF CLC +G+
Sbjct  1859  GTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGF  1918

Query  1797  ELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSESCIDINECNEDPN  1856
             ELT DGKNC+DTNEC++L G+C PGTCQNLEGSFRCICPPG++V+S+ CIDI+EC+E+PN
Sbjct  1919  ELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPN  1978

Query  1857  ICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAK  1916
             +CLFG+CTN+PG FQC+CP GFVLSDNG RCFDTRQSFCFT FE GKCSVPKAFNTTK +
Sbjct  1979  LCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTR  2038

Query  1917  CCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNG  1976
             CCCSK PGEGWGDPCELCP+E   AFQ+LCP+GHG +PG DD+REDVNEC E+PGVC+NG
Sbjct  2039  CCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGVCTNG  2098

Query  1977  HCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGNGTCTNVIGSFECNCHEGFEP  2036
              C+NTDGSFRCECP GY+LD+TG++C+DTDECS+G+PCG GTCTNVIG FEC C +GFEP
Sbjct  2099  VCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCGQGTCTNVIGGFECACADGFEP  2158

Query  2037  GPMMNCE  2043
             G MM CE
Sbjct  2159  GLMMTCE  2165


 Score = 785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 667/1978 (34%), Positives = 868/1978 (44%), Gaps = 349/1978 (18%)

Query  1     DYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNI  60
             D   G C+ ++    C+  L G    ++ CCAT+G AWG PCE C   P  C RGF    
Sbjct  806   DSTKGTCWLKIQESRCEVNLQGAS-LRSECCATLGAAWGSPCERCEIDPA-CARGFA---  860

Query  61    RTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGIC  120
                          + GV                             CDD++EC   PG+C
Sbjct  861   ------------RMTGV----------------------------TCDDVNECESFPGVC  880

Query  121   EGSECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQELPGRFTKRQCC  180
                 C NT GS+ C CP G +    G  C+D R   CF       C   LPG++    CC
Sbjct  881   PNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCC  940

Query  181   CESGRCWAMGSVPEMCPVRGSDEYRRLCVDGAPAGGGSRGGGTGGNGFLPSGNGNGHGHG  240
             C  G  W  G   E CP   S E+  LC          RG G     FL           
Sbjct  941   CSIGAVW--GVECEACPDPESLEFASLC---------PRGLGFASRDFL-----------  978

Query  241   PRGAGFIPIPGSNGFSPGVGGAG-----VGTGSSTGNGPIITGLTILNQT-IDICKHHPD  294
               G  F          PG+   G     VG+      G         N T ID C+  PD
Sbjct  979   -SGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISPD  1037

Query  295   LCLNGRCIPTLSSYRCECNMGYKQD--SNGDCTDVDECTSNP--CSNGDCVNTPGSYYCK  350
             LC  G C+ T  S+ CEC  GY+       +C DVDEC  +P  C  G C NT GSY C+
Sbjct  1038  LCGQGTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQ  1097

Query  351   CHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHD  410
             C  G + T    AC DIDEC  +  LC +G+CVN  G+FQC C+AGF+ T D + CVD +
Sbjct  1098  CPPGHELTAKGTACEDIDECSLSDGLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDIN  1157

Query  411   ECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTS-GICMNGHCINTEG  469
             EC   N   +  CIN +GS++C C  G+ L P+GR C D+DEC+ +  +C  GHC N  G
Sbjct  1158  ECRVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDECEENPRVCDQGHCTNMPG  1217

Query  470   SFRCECPPGLAVGVDGRV------------------CVDTHMRSTCYGGIKKGACVRP--  509
               RC C  G     D R                   C +T     C+   + G  VR   
Sbjct  1218  GHRCLCYDGFMATPDMRTCVDVDECDLNPHICLHGDCENTKGSFVCH--CQLGYMVRKGA  1275

Query  510   ----------FPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGL-------------  546
                         G    S   C N    F   C P    +  E H L             
Sbjct  1276  TGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSPR  1335

Query  547   -----------CSSGIGITVDG---RDINECALDPDICSNGICENLRGSYRCNCNSGYEP  592
                        C+   G   DG    D +ECA + D+C NG C N  G YRC C  G++P
Sbjct  1336  GDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDP  1395

Query  593   DPSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINEC-ESSP  651
                 R C D+DEC+   L C  G C N PG + C C  GY        C DINEC +   
Sbjct  1396  TEDHRACQDVDECAQGNL-CAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVN  1454

Query  652   CVNGACRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDS-----RCEVNINGAT  706
             C+NG C N  GS+ C C    +L+ +G+ C+D+  G C+L   D       C   I    
Sbjct  1455  CINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGV  1514

Query  707   LKSECCATLGAAWGSPCERC------ELDTAC--SRGFA--RVNGVTCEDVNECDVFPGV  756
              ++ CC +LG AWG+PCE C      E  T C    GF   R+  V  ED++EC   PG+
Sbjct  1515  TRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRIT-VILEDIDECQELPGL  1573

Query  757   CPNGRCINSRGSFHCECPEGLTLDGTGRVC------------------------------  786
             C  G C+N+ GSF CECP G  L    R+C                              
Sbjct  1574  CQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGTCYNTLGNYTCVCP  1633

Query  787   ------------LDIRMEQCYLTWDEDECIRSVPGKFRMDACCCA--VGAAWGSDCEECP  832
                         +D+R   C+  ++   C   +        CCC+  +G AW   CE CP
Sbjct  1634  AEYLQVNGGNNCMDMRKSVCFRHYN-GTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACP  1692

Query  833   KPDTKEYEALCP-RGPGFSNRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKC  891
              P + +Y+ LC  + PGF    DI TG+P   DI+EC   P +C NG C N IGSF+C+C
Sbjct  1693  TPISPDYQILCGNQAPGFLT--DIHTGKPL--DIDECGEIPAICANGICINQIGSFRCEC  1748

Query  892   NSGFTLDMEERNCTDIDECWISPDLCGSGT-CVNTPGSFECECFDGYE------------  938
              +GF  +     C D+DEC      C     C+N PGS+ C+C  GY+            
Sbjct  1749  PAGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNE  1808

Query  939   -------------------------SGFMMMKN---CMDIDECERNPLLCRGGTCVNTEG  970
                                       GF    +   CMDIDEC+R P  C  GTC N  G
Sbjct  1809  CREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQP--CGNGTCKNIIG  1866

Query  971   SFQCDCPLGHELSPSREECIDVNECS-LSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRR  1029
             S+ C C  G  ++    +C+D +EC+ L   +CR G C+N  G++ C C  G++ T D +
Sbjct  1867  SYNCLCFPGFVVT-HNGDCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGK  1925

Query  1030  SCTDIDECMIMNGGCHT-HCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGG  1088
             +C D +EC+ + G C    C N EGS+ C C  G+ +  D   C DIDEC   P++C  G
Sbjct  1926  NCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSD--HCIDIDECSEEPNLCLFG  1983

Query  1089  QCTNIPGEYRCLCYDGFMASMDMKTCIDVNE----CDLNSNICMFGECENT---------  1135
              CTN PG ++CLC  GF+ S +   C D  +        +  C   +  NT         
Sbjct  1984  TCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSK  2043

Query  1136  -----------------KGSFICHCQLGYSVKKGTTGCT-DVDECEIGAHNCDMHASCVN  1177
                                +F   C  G+    G      DV+EC      C  +  CVN
Sbjct  2044  RPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGVC-TNGVCVN  2102

Query  1178  VPGSFKCSCREGWVGN--GIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFT-GD  1234
               GSF+C C  G+  +  GI C+D DECS G H C     C N  G + CAC +GF  G 
Sbjct  2103  TDGSFRCECPFGYSLDFTGINCVDTDECSVG-HPCG-QGTCTNVIGGFECACADGFEPGL  2160

Query  1235  GFTCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECS--FQNIC  1292
               TC D+DEC+ N  LC   +C N  G+Y C C  G+T   D   C+D++EC+   Q+  
Sbjct  2161  MMTCEDIDECSLNPLLCAF-RCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCH  2219

Query  1293  VFGT-CNNLPGMFHCICDDGYE-LDRTGGNCTDVDEC-ADPINCVNGLCVNTPGRYECNC  1349
               G  C NL G F C+C  G   L  +G  CTD +EC A P  CVNG CVNT G + C+C
Sbjct  2220  ARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQPDLCVNGRCVNTAGSFRCDC  2279

Query  1350  PPDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPC  1409
                FQ +PT   C D R G C+ +       SLS ++E    V+R+ CCC  G+ WG  C
Sbjct  2280  DEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSE---AVTRAECCCGGGRGWGPRC  2336

Query  1410  ETCPPVNSTEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECP  1469
             E CP   ++ Y  LCP G G+     T    D+DEC+ L  LC  G CIN+ GSF+C C 
Sbjct  2337  ELCPLPGTSAYRKLCPHGSGY-----TAEGRDVDECRMLAHLCAHGECINSLGSFRCHCQ  2391

Query  1470  KGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKS  1529
              GY        C D+DEC   P  C    C NT G++ C CP  Y+    G  C D+ + 
Sbjct  2392  AGYTPDATATTCLDMDECSQVPKPC-TFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDEC  2450

Query  1530  FCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFT  1589
                     TS ++   F        C   VG    +    CP              PGFT
Sbjct  2451  --------TSRQHNCQF-------LCVNTVGAFTCR----CP--------------PGFT  2477

Query  1590  FDIHSGKAVDIDECKEIPGIC-ANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNG  1648
                H     D DEC   PG C A+G C N  GSFRCEC  GF+       CED++EC +G
Sbjct  2478  --QHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNEC-DG  2534

Query  1649  DNLCQRNADCINSPGSYRCECAAGF-KLSPNGACVDRNECLEIPNVCSHGLCVDMQGSYK  1707
              + CQ    C N  G YRC C  GF + S    CVD NEC   P  C    C +  G ++
Sbjct  2535  PHRCQHG--CQNQLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTCGSASCRNTLGGFR  2592

Query  1708  CICHNGFKASQDQTMCMDVDEC--ERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCM  1763
             C+C +GF   Q    C +VDEC   R PC   +C NT G + C C  G+       C+
Sbjct  2593  CVCPSGFDFDQALGGCQEVDECAGRRGPCSY-SCANTPGGFLCGCPQGYFRAGQGHCV  2649


 Score = 783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 711/2277 (31%), Positives = 962/2277 (42%), Gaps = 404/2277 (18%)

Query  52    CRRGFIPNIRTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDID  111
             C  G+  ++R G C DVDEC + P  C  G+C+N  G+Y C+C  G +     Q C D+D
Sbjct  435   CNVGYTQDVR-GECIDVDECTSSP--CHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVD  491

Query  112   ECSIIPGICEGSECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQELP  171
             EC +  G+C    C NT GS+ C+C  G+  S DG  C+D       +  VNG C  E  
Sbjct  492   ECIVSGGLCHLGRCVNTEGSFQCVCNAGFELSPDGKNCVDHNECATSTMCVNGVCLNE-D  550

Query  172   GRFTKRQCCCESGRCWAMGSVPEMCPVRGSDEYRRLCVDG--APAGGGSRGGGTGGNGFL  229
             G F+   C C+ G   A G     C      +   +CV+G      G  R    GG    
Sbjct  551   GSFS---CLCKPGFLLAPGG--HYCMDIDECQTPGICVNGHCTNTEGSFRCQCLGGLAVG  605

Query  230   PSGN--------GNGHGHGPRGAGFIPIPGS------------NGFS------PGVGGAG  263
               G            +G   +G+   P PG+            +GF       P    A 
Sbjct  606   TDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAE  665

Query  264   VGTGSSTGNGPIITGLTILNQTIDICKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNG-  322
                  S+G      G+T   + I+ C   P++C NG C     SYRC CN+GY+  ++G 
Sbjct  666   FQALCSSG-----LGITTDGRDINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGK  720

Query  323   DCTDVDECTSNP--CSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNG  380
             DCTDVDEC  N   C NG C N+PGSY C C  GF      + C D+DEC+ +   C +G
Sbjct  721   DCTDVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSS--PCVSG  778

Query  381   RCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMC-INEDGS----------  429
              C N  GS+ C C  G  L   G  C+D  + T         C +N  G+          
Sbjct  779   VCRNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATL  838

Query  430   ------------FKCICKPGFVLAPNGRYCTDIDECQT-SGICMNGHCINTEGSFRCECP  476
                             C  GF     G  C D++EC++  G+C NG C+NT GSFRCECP
Sbjct  839   GAAWGSPCERCEIDPACARGFARM-TGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECP  897

Query  477   PGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCP  536
              GL +   GR+CVD  +   C+    +  C    PG      CCC+     +G  C  CP
Sbjct  898   EGLMLDASGRLCVDVRLEP-CFLRWDEDECGVTLPGKYRMDVCCCSIGAV-WGVECEACP  955

Query  537   AKNSAEFHGLCSSGIGIT----VDGR----DINECALDPDICSNGICENLRGSYRCNCNS  588
                S EF  LC  G+G      + GR    D+NEC + P +C++G C N  GS+ C C  
Sbjct  956   DPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAG  1015

Query  589   GYEPDPSGRNCVDIDECSV-----------------------------------------  607
             G+  D   RNC DIDEC +                                         
Sbjct  1016  GFALDAQERNCTDIDECRISPDLCGQGTCVNTPGSFECECFPGYESGFMLMKNCMDVDEC  1075

Query  608   --NRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINECESSP--CVNGACRNNLGS  663
               + LLC  G C NT GSY C CP G+  + +   CEDI+EC  S   C +G C N +G+
Sbjct  1076  ARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLCPHGQCVNVIGA  1135

Query  664   FNCECSPG--SKLDSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAW--  719
             F C C  G  S  D  G + I+  +      +Q+  C+V+         C    G +   
Sbjct  1136  FQCSCHAGFQSTPDRQGCVDINECR------VQNGGCDVHCINTEGSYRCSCGQGYSLMP  1189

Query  720   -GSPC---ERCELDT-----------------ACSRGF-ARVNGVTCEDVNECDVFPGVC  757
              G  C   + CE +                   C  GF A  +  TC DV+ECD+ P +C
Sbjct  1190  DGRACADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLNPHIC  1249

Query  758   PNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYL---TWDEDECIRSVPGKFRMD  814
              +G C N++GSF C C  G  +      C D+  ++C +     D      ++PG F   
Sbjct  1250  LHGDCENTKGSFVCHCQLGYMVRKGATGCSDV--DECEVGGHNCDSHASCLNIPGSF---  1304

Query  815   ACCCAVGAAWGSDCEECPKPD--TKEYEALCPRGPGFSNRGDI-------LTGRPFY-KD  864
             +C C  G  W  D  EC   D    +     PRG   +  G           G  F+ +D
Sbjct  1305  SCRCLPG--WVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCED  1362

Query  865   INECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVN  924
              +EC     +C NG+C N  G ++C+C  GF    + R C D+DEC    +LC  G+C N
Sbjct  1363  RDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDEC-AQGNLCAFGSCEN  1421

Query  925   TPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSP  984
              PG F C C  GYE       NC DI+EC  +P+ C  G C+NT GS+ C CP   EL+P
Sbjct  1422  LPGMFRCICNGGYELD-RGGGNCTDINECA-DPVNCINGVCINTPGSYLCSCPQDFELNP  1479

Query  985   SREECIDVNECSLSDSLCRNGKC---VNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMN  1041
             S   C+D           R G C    +  G    SC++       R SC          
Sbjct  1480  SGVGCVDT----------RAGNCFLETHDRGDSGISCSAEIGVGVTRASCC-CSLGRAWG  1528

Query  1042  GGCHTHCTNSEGSYECSCSDGYALMPDVRTCA--DIDECESNPDICDGGQCTNIPGEYRC  1099
               C      +   Y   C  G    P+  T    DIDEC+  P +C GG C N  G ++C
Sbjct  1529  NPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQC  1588

Query  1100  LCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDV  1159
              C  G+  S   + C D++EC  +S IC  G C NT G++ C C   Y    G   C D+
Sbjct  1589  ECPPGYHLSEHTRICEDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDM  1648

Query  1160  DECEIGAH---------------------------------------NCDMHASCVNVPG  1180
              +     H                                       + D    C N   
Sbjct  1649  RKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAP  1708

Query  1181  SFKCSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDG--FTC  1238
              F      G      K +D+DEC      C+ N  C+N  GS+ C C  GF  +     C
Sbjct  1709  GFLTDIHTG------KPLDIDECGEIPAICA-NGICINQIGSFRCECPAGFNYNSILLAC  1761

Query  1239  SDVDECAENVHLCE-NGQCLNVPGAYRCECEMGFTPASDSKSCQDINEC-SFQNICVFGT  1296
              DVDEC      C+ N  C+N+PG+YRC+C  G+   S   +C   NEC    N+C  G 
Sbjct  1762  EDVDECGSRESPCQQNADCINIPGSYRCKCTRGYK-LSPGGACVGRNECREIPNVCSHGD  1820

Query  1297  CNNLPGMFHCICDDGYELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLN  1356
             C +  G + C+C  G++       C D+DEC D   C NG C N  G Y C C P F + 
Sbjct  1821  CMDTEGSYMCLCHRGFQASADQTLCMDIDEC-DRQPCGNGTCKNIIGSYNCLCFPGFVVT  1879

Query  1357  PTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVN  1416
               G  CVD                   C T +G       C  + G              
Sbjct  1880  HNG-DCVDFD----------------ECTTLVGQVCRFGHCLNTAGS-------------  1909

Query  1417  STEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSE  1476
                ++ LC   +GF          D +EC  L G C  G C N  GSF+C CP G+ +  
Sbjct  1910  ---FHCLCQ--DGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQS  1964

Query  1477  ETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYN  1536
             +   C DIDEC   P +C  GTC N+ G++ C+CPP ++  + GH C D R+SFC+  + 
Sbjct  1965  DH--CIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFE  2022

Query  1537  GTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNIC----GNIPGFTFDI  1592
                C     FN TK  CCC+   G+ W  PCE CP  G+A F+ +C    G +PG     
Sbjct  2023  AGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPG-----  2077

Query  1593  HSGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLC  1652
                   D++EC E PG+C NGVC+N  GSFRCECP G+S +   + C D DECS G    
Sbjct  2078  PDDSREDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCG  2137

Query  1653  QRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHN  1712
             Q    C N  G + C CA GF+      C D +EC   P +C+   C + +GSY C C  
Sbjct  2138  Q--GTCTNVIGGFECACADGFEPGLMMTCEDIDECSLNPLLCAF-RCHNTEGSYLCTCPA  2194

Query  1713  GFKASQDQTMCMDVDEC-------------------------------------------  1729
             G+   +D  MC DVDEC                                           
Sbjct  2195  GYTLREDGAMCRDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDN  2254

Query  1730  ----ERHPCGNGTCKNTVGSYNCLCYPGFELTHN-NDCMDIDECSSF---FGQVCRNGRC  1781
                 +   C NG C NT GS+ C C  GF+ +    +C DI +   F      +CR+   
Sbjct  2255  ECHAQPDLCVNGRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSS  2314

Query  1782  FNE--------------------------IGSFKCLCNEGYELTLDGKNCIDTNECVALP  1815
              +E                            +++ LC  G   T +G+   D +EC  L 
Sbjct  2315  SSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGR---DVDECRMLA  2371

Query  1816  GSCSPGTCQNLEGSFRCICPPGY--EVKSESCIDINECNEDPNICLFGSCTNTPGGFQCI  1873
               C+ G C N  GSFRC C  GY  +  + +C+D++EC++ P  C F  C NT G F C 
Sbjct  2372  HLCAHGECINSLGSFRCHCQAGYTPDATATTCLDMDECSQVPKPCTF-LCKNTKGSFLCS  2430

Query  1874  CPTGFVLSDNGRRCFDTR---------QSFCFTNFENGKCSVPKAFNTTKAKCC----CS  1920
             CP G++L ++GR C D           Q  C        C  P  F      C     CS
Sbjct  2431  CPRGYLLEEDGRTCKDLDECTSRQHNCQFLCVNTVGAFTCRCPPGFTQHHQACFDNDECS  2490

Query  1921  KMPGE-GWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNGHCI  1979
               PG  G    C   P     +F+  C  G  T+       EDVNEC + P  C +G C 
Sbjct  2491  AQPGPCGAHGHCHNTPG----SFRCECHQGF-TLVSSGHGCEDVNEC-DGPHRCQHG-CQ  2543

Query  1980  NTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNP-CGNGTCTNVIGSFECNCHEGFE  2035
             N  G +RC CP G+        C+D +EC++  P CG+ +C N +G F C C  GF+
Sbjct  2544  NQLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTCGSASCRNTLGGFRCVCPSGFD  2600


 Score = 662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/1835 (32%), Positives = 795/1835 (43%), Gaps = 306/1835 (17%)

Query  326   DVDECTSNP--CSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCV  383
             DV+EC   P  C++G C NT GS++C C  GF     ++ C DIDEC  +  LC  G CV
Sbjct  986   DVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISPDLCGQGTCV  1045

Query  384   NTDGSFQCICNAGFEL-TTDGKNCVDHDECTTTNM-CLNGMCINEDGSFKCICKPGFVLA  441
             NT GSF+C C  G+E      KNC+D DEC    + C  G C N DGS+KC C PG  L 
Sbjct  1046  NTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELT  1105

Query  442   PNGRYCTDIDECQTS-GICMNGHCINTEGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGG  500
               G  C DIDEC  S G+C +G C+N  G+F+C C  G     D + CVD +        
Sbjct  1106  AKGTACEDIDECSLSDGLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECR-----  1160

Query  501   IKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGLCSSGIGITVDGR--  558
             ++ G C           +  C N +                 +   C  G  +  DGR  
Sbjct  1161  VQNGGC-----------DVHCINTE---------------GSYRCSCGQGYSLMPDGRAC  1194

Query  559   -DINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLC  617
              D++EC  +P +C  G C N+ G +RC C  G+   P  R CVD+DEC +N  +C +G C
Sbjct  1195  ADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLNPHICLHGDC  1254

Query  618   RNTPGSYSCTCPKGYVFSTETDTCEDINECESSPC---VNGACRNNLGSFNCECSPGSKL  674
              NT GS+ C C  GY+       C D++ECE        + +C N  GSF+C C PG   
Sbjct  1255  ENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVG  1314

Query  675   DSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACSR  734
             D  G  C D  +       Q+ RC       + + +C    G+       RC     C +
Sbjct  1315  D--GFECHDLDECV----SQEHRC-------SPRGDCLNVPGSY------RC----TCRQ  1351

Query  735   GFARVNGVTCEDVNECDVFPGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQC  794
             GFA  +G  CED +EC     +C NG+C+N+ G + CEC  G       R C D+     
Sbjct  1352  GFAG-DGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDV-----  1405

Query  795   YLTWDEDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGD  854
                   DEC +   G        CA G+     CE  P      +  +C  G      G 
Sbjct  1406  ------DECAQ---GNL------CAFGS-----CENLPG----MFRCICNGGYELDRGGG  1441

Query  855   ILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTD--------  906
               T      DINEC   P  C+NG C NT GS+ C C   F L+     C D        
Sbjct  1442  NCT------DINEC-ADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFL  1494

Query  907   ----------------------------IDECWISP-DLCGSGTCVNTPGSFECECFDGY  937
                                         +   W +P +LC       T     C   +G+
Sbjct  1495  ETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMAN--TTEYRTLCPGGEGF  1552

Query  938   ESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSL  997
             +   + +    DIDEC+  P LC+GG CVNT GSFQC+CP G+ LS     C D++ECS 
Sbjct  1553  QPNRITVI-LEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECST  1611

Query  998   SDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIM---NGGCHTHCTNSEGS  1054
                +C  G C N +G Y C C + Y       +C D+ + +     NG C      +   
Sbjct  1612  HSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTR  1671

Query  1055  YECSCS----------------------------DGYALMPDVRTCA--DIDECESNPDI  1084
               C CS                                 + D+ T    DIDEC   P I
Sbjct  1672  KMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAI  1731

Query  1085  CDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMF-GECENTKGSFICHC  1143
             C  G C N  G +RC C  GF  +  +  C DV+EC    + C    +C N  GS+ C C
Sbjct  1732  CANGICINQIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKC  1791

Query  1144  QLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIK--CIDLD  1201
               GY +  G   C   +EC    + C  H  C++  GS+ C C  G+  +  +  C+D+D
Sbjct  1792  TRGYKLSPGGA-CVGRNECREIPNVCS-HGDCMDTEGSYMCLCHRGFQASADQTLCMDID  1849

Query  1202  ECSNGTHQCSVNAQCVNSPGSYLCACVEGF--TGDGFTCSDVDECAENV-HLCENGQCLN  1258
             EC     Q   N  C N  GSY C C  GF  T +G  C D DEC   V  +C  G CLN
Sbjct  1850  ECD---RQPCGNGTCKNIIGSYNCLCFPGFVVTHNG-DCVDFDECTTLVGQVCRFGHCLN  1905

Query  1259  VPGAYRCECEMGFTPASDSKSCQDINEC-SFQNICVFGTCNNLPGMFHCICDDGYELDRT  1317
               G++ C C+ GF   +D K+C D NEC S    C+ GTC NL G F CIC  G+++   
Sbjct  1906  TAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSD  1965

Query  1318  GGNCTDVDECADPIN-CVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKYGP  1376
               +C D+DEC++  N C+ G C N+PG ++C CPP F L+  G  C D R   C+ ++  
Sbjct  1966  --HCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFE-  2022

Query  1377  RGDGSLSCNTEIGVGVSRSSCCCSL--GKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNP  1434
                 +  C+       +++ CCCS   G+ WG+PCE CP   S  +  LCP G G  P P
Sbjct  2023  ----AGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGP  2078

Query  1435  ITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDEC-VAHPGV  1493
                  ED++EC E PG+C  G C+NT GSF+CECP GY L      C D DEC V HP  
Sbjct  2079  DDS-REDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHP--  2135

Query  1494  CGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMC  1553
             CG GTC N +G + C C   + +      C D+ +     S N   C           +C
Sbjct  2136  CGQGTCTNVIGGFECACADGF-EPGLMMTCEDIDEC----SLNPLLCAFRCHNTEGSYLC  2190

Query  1554  CC----TYNVGKAWNKPCEPCP------TPGTAEFKNICGNI-----PGFTFDIHSGKA-  1597
              C    T     A  +  + C            E KN+ G       PG      SG+  
Sbjct  2191  TCPAGYTLREDGAMCRDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGC  2250

Query  1598  VDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNAD  1657
              D +EC   P +C NG C+N  GSFRC+C  GF  +  L  C DI           R   
Sbjct  2251  TDDNECHAQPDLCVNGRCVNTAGSFRCDCDEGFQPSPTLTECHDI-----------RQGP  2299

Query  1658  CINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHG---LC-VDMQGSYKCICHNG  1713
             C        C       LS +   V R EC             LC +    +Y+ +C +G
Sbjct  2300  CFAEVLQTMCR-----SLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHG  2354

Query  1714  FKASQDQTMCMDVDECER--HPCGNGTCKNTVGSYNCLCYPGFELTHN-NDCMDIDECSS  1770
                + +     DVDEC    H C +G C N++GS+ C C  G+        C+D+DECS 
Sbjct  2355  SGYTAEG---RDVDECRMLAHLCAHGECINSLGSFRCHCQAGYTPDATATTCLDMDECS-  2410

Query  1771  FFGQVCR--NGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEG  1828
                QV +     C N  GSF C C  GY L  DG+ C D +EC +   +C    C N  G
Sbjct  2411  ---QVPKPCTFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQ-FLCVNTVG  2466

Query  1829  SFRCICPPGYEVKSESCIDINECNEDPNIC-LFGSCTNTPGGFQCICPTGFVLSDNGRRC  1887
             +F C CPPG+    ++C D +EC+  P  C   G C NTPG F+C C  GF L  +G  C
Sbjct  2467  AFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGC  2526

Query  1888  FDTR--------QSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEE  1939
              D          Q  C       +CS P+ F        C                    
Sbjct  2527  EDVNECDGPHRCQHGCQNQLGGYRCSCPQGFTQHSQWAQCV-------------------  2567

Query  1940  VAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTG  1999
                                   D NEC  SP  C +  C NT G FRC CP G++ D   
Sbjct  2568  ----------------------DENECALSPPTCGSASCRNTLGGFRCVCPSGFDFDQAL  2605

Query  2000  VHCIDTDECSIGNPCGNGTCTNVIGSFECNCHEGF  2034
               C + DEC+      + +C N  G F C C +G+
Sbjct  2606  GGCQEVDECAGRRGPCSYSCANTPGGFLCGCPQGY  2640


 Score = 107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 97/351 (28%), Positives = 134/351 (38%), Gaps = 103/351 (29%)

Query  1789  KCLCNEGYELTL-----------DGKNCIDTNECVALP-----------------GSCSP  1820
              CLC +GY  T+           +G  CI  N C  +                  G   P
Sbjct  134   SCLCQKGYTGTVCGQPICDRGCHNGGRCIGPNRCACVYGFMGPQCERDYRTGPCFGQVGP  193

Query  1821  GTCQNLEGSFRC------------------ICPP-------GY--EVKSESCIDINECNE  1853
               CQ+      C                  +CP        G+   + + +C D++EC  
Sbjct  194   EGCQHQLTGLVCTKALCCATVGRAWGLPCELCPAQPHPCRRGFIPNIHTGACQDVDECQA  253

Query  1854  DPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTT  1913
              P +C  GSC N  G F C CP G  LSD+   C D R   CF+    G+C+   A + T
Sbjct  254   VPGLCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFGGRCAGDLAGHYT  313

Query  1914  KAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLC-------PYGHGTIPGI----------  1956
             + +CCC +      G   ELCP      FQ LC       P   G  PG+          
Sbjct  314   RRQCCCDRGRCWAAGPVPELCPPRGSNEFQQLCAQRLPLLPGHPGLFPGLLGFGSNGMGP  373

Query  1957  -----------DDTR------------------EDVNECLESPGVCSNGHCINTDGSFRC  1987
                         D R                  + ++ C     +C NG C+ T  S+RC
Sbjct  374   PLGPARLNPHGSDARGIPSLGPGNSNIGTATLNQTIDICRHFTNLCLNGRCLPTPSSYRC  433

Query  1988  ECPMGYNLDYTGVHCIDTDECSIGNPCGNGTCTNVIGSFECNCHEGFEPGP  2038
             EC +GY  D  G  CID DEC+  +PC +G C N+ G++ C C+ GF+  P
Sbjct  434   ECNVGYTQDVRG-ECIDVDECT-SSPCHHGDCVNIPGTYHCRCYPGFQATP  482


> sp|P35555|FBN1_HUMAN Fibrillin-1 OS=Homo sapiens GN=FBN1 PE=1 
SV=3
Length=2871

 Score = 2502 bits (6484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1213/1764 (69%), Positives = 1445/1764 (82%), Gaps = 12/1764 (1%)

Query  285   TIDICKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNGDCTDVDECTSNPCSNGDCVNTP  344
               D C+    LC NGRCIPT  S RCECN G++ D  G+C DVDEC  NPC+ G+C+N  
Sbjct  449   VTDYCQLVRYLCQNGRCIPTPGSCRCECNKGFQLDLRGECIDVDECEKNPCAGGECINNQ  508

Query  345   GSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGK  404
             GSY C+C AG+Q T T+  C DIDEC+QNG +C NGRC+NTDGSF C+CNAGF +T DGK
Sbjct  509   GSYTCQCRAGYQSTLTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGK  568

Query  405   NCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTSGICMNGHC  464
             NC D DEC+  NMCLNGMCINEDGSFKCICKPGF LA +GRYC DI+EC+T GICMNG C
Sbjct  569   NCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRC  628

Query  465   INTEGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANP  524
             +NT+GS+RCEC PGLAVG+DGRVCVDTHMRSTCYGG K+G C++P  GAVTKSECCCA+ 
Sbjct  629   VNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCIKPLFGAVTKSECCCAST  688

Query  525   DYGFGEPCHPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICSNGICENLRGSYRC  584
             +Y FGEPC PCPA+NSAE+  LCSSG G+T  G DINECALDPDIC NGICENLRG+Y+C
Sbjct  689   EYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGSDINECALDPDICPNGICENLRGTYKC  748

Query  585   NCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDI  644
              CNSGYE D +G+NCVDI+EC +N LLCDNG CRNTPGS+ CTCPKG+++  +  TCEDI
Sbjct  749   ICNSGYEVDSTGKNCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFIYKPDLKTCEDI  808

Query  645   NECESSPCVNGACRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVNING  704
             +ECESSPC+NG C+N+ GSF CECS  S LD T  ICI+++KGTCW  + D RCE+NING
Sbjct  809   DECESSPCINGVCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEINING  868

Query  705   ATLKSECCATLGAAWGSPCERCELDTACSRGFARVNGVTCEDVNECDVFPGVCPNGRCIN  764
             ATLKS+CC++LGAAWGSPC  C++D  C +G++R+ G  CED++EC+VFPGVC NG C+N
Sbjct  869   ATLKSQCCSSLGAAWGSPCTLCQVDPICGKGYSRIKGTQCEDIDECEVFPGVCKNGLCVN  928

Query  765   SRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRMDACCCAVGAAW  824
             +RGSF C+CP G+TLD TGR+CLDIR+E C+L ++++EC   + G+ RMDACCC+VGAAW
Sbjct  929   TRGSFKCQCPSGMTLDATGRICLDIRLETCFLRYEDEECTLPIAGRHRMDACCCSVGAAW  988

Query  825   GSD-CEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNGKCRNT  883
             G++ CEECP  +T EYE LCPRGPGF+ + +I  G+PF+KDINECK+ P +C +GKCRNT
Sbjct  989   GTEECEECPMRNTPEYEELCPRGPGFATK-EITNGKPFFKDINECKMIPSLCTHGKCRNT  1047

Query  884   IGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMM  943
             IGSFKC+C+SGF LD EERNCTDIDEC ISPDLCG G CVNTPG FEC+C +GYESGFMM
Sbjct  1048  IGSFKCRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMM  1107

Query  944   MKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCR  1003
             MKNCMDIDEC+R+PLLCRGG C NTEGS++C+CP GH+LSP+   CID+NEC LS  LC 
Sbjct  1108  MKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISACIDINECELSAHLCP  1167

Query  1004  NGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGY  1063
             NG+CVN++G YQC+CN GY +TPDR  C DIDEC IMNGGC T CTNSEGSYECSC  G+
Sbjct  1168  NGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCETFCTNSEGSYECSCQPGF  1227

Query  1064  ALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLN  1123
             ALMPD R+C DIDECE NP+ICDGGQCTNIPGEYRCLCYDGFMAS DMKTC+DVNECDLN
Sbjct  1228  ALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLN  1287

Query  1124  SNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFK  1183
              NIC+ G CENTKGSFICHC +GYS KKG TGCTD++ECEIGAHNC  HA C N  GSFK
Sbjct  1288  PNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGKHAVCTNTAGSFK  1347

Query  1184  CSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDE  1243
             CSC  GW+G+GIKC DLDECSNGTH CS +A C N+ GSY C C EG+TGDGFTC+D+DE
Sbjct  1348  CSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGDGFTCTDLDE  1407

Query  1244  CAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGM  1303
             C+EN++LC NGQCLN PG YRCEC+MGF P++D K+C+DI+ECS  NICVFGTC+NLPG+
Sbjct  1408  CSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGL  1467

Query  1304  FHCICDDGYELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCV  1363
             F C C+ GYELDR+GGNCTDV+EC DP  C++G CVNTPG Y C+CPPDF+LNPT VGCV
Sbjct  1468  FRCECEIGYELDRSGGNCTDVNECLDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCV  1527

Query  1364  DNRVGNCYLKYGPRGD-GSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNT  1422
             D R GNCYL   PRGD G  +C+ EIGVGVS++SCCCSLGKAWG PCE CP VN++EY  
Sbjct  1528  DTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKI  1587

Query  1423  LCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICE  1482
             LCPGGEGFRPNPIT+ILEDIDECQELPGLCQGG CINTFGSFQC CP GYYL+E+TR+C+
Sbjct  1588  LCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCD  1647

Query  1483  DIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSY--NGTSC  1540
             D++EC   PG+CGPGTCYNT+GNYTCICPP+YMQVNGG+NCMDMR+S CYR+Y  +  +C
Sbjct  1648  DVNECET-PGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTC  1706

Query  1541  ENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNI-PGFTFDIHSGKAVD  1599
             + EL FN+TK+MCCC+YN+G+AWNKPCE CP P T EF  +CG+  PGF  DI++G  VD
Sbjct  1707  DGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVD  1766

Query  1600  IDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCI  1659
             IDEC+EIPG+C NGVCIN +GSFRCECP GF YND LLVCEDIDEC NG  +CQRNA+CI
Sbjct  1767  IDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGP-VCQRNAECI  1825

Query  1660  NSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQD  1719
             N+ GSYRC+C  G++ +  G C DRNEC EIPN+CSHG C+D  GS+ C+CH GFK + D
Sbjct  1826  NTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNDD  1885

Query  1720  QTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSFFGQVCRNG  1779
             QTMC+D++ECER  CGNGTC+NT+GS+NC C  GF L+HNNDC+D+DEC+S  G +CRNG
Sbjct  1886  QTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECASGNGNLCRNG  1945

Query  1780  RCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYE  1839
             +C N +GSF+C CNEGYE+  DG+ C+D NEC+  P  C+PGTCQNL+GS+RCICPPGY 
Sbjct  1946  QCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAPGTCQNLDGSYRCICPPGYS  2005

Query  1840  VKSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNF  1899
             +++E C DI+EC E+P IC  G+C+NT G F+C+CP GF LS +GRRC D R S+C+  F
Sbjct  2006  LQNEKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSSGRRCQDLRMSYCYAKF  2065

Query  1900  ENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDT  1959
             E GKCS PK+ N +K +CCC+ + GEGWGDPCELCP E + AF+ +CPYG G I G DD+
Sbjct  2066  EGGKCSSPKSRNHSKQECCCA-LKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDS  2124

Query  1960  REDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGNGTC  2019
               D++EC E P VC +G CINTDGS+RCECP GY L   G  C+DTDECS+GNPCGNGTC
Sbjct  2125  AVDMDECKE-PDVCKHGQCINTDGSYRCECPFGYIL--AGNECVDTDECSVGNPCGNGTC  2181

Query  2020  TNVIGSFECNCHEGFEPGPMMNCE  2043
              NVIG FEC C EGFEPGPMM CE
Sbjct  2182  KNVIGGFECTCEEGFEPGPMMTCE  2205


 Score = 819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 655/1968 (33%), Positives = 879/1968 (45%), Gaps = 340/1968 (17%)

Query  5     GPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGA  64
             G C+  V +  C+  + G    K+ CC+++G AWG PC +C   P               
Sbjct  851   GTCWQTVIDGRCEININGAT-LKSQCCSSLGAAWGSPCTLCQVDP---------------  894

Query  65    CQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICEGSE  124
                                          C  G+ + + TQ C+DIDEC + PG+C+   
Sbjct  895   ----------------------------ICGKGYSRIKGTQ-CEDIDECEVFPGVCKNGL  925

Query  125   CSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQELPGRFTKRQCCCESG  184
             C NT GS+ C CP G      G  C+D R  TCF    +  C   + GR     CCC  G
Sbjct  926   CVNTRGSFKCQCPSGMTLDATGRICLDIRLETCFLRYEDEECTLPIAGRHRMDACCCSVG  985

Query  185   RCWAMGSVPEMCPVRGSDEYRRLCVDGAPAGGGSRGGGTGGNGFLPSGNGNGHGHGPRGA  244
               W      E CP+R + EY  LC  G    G +    T G  F    N           
Sbjct  986   AAWGTEECEE-CPMRNTPEYEELCPRGP---GFATKEITNGKPFFKDIN---------EC  1032

Query  245   GFIPIPGSNGFSPGVGGAGVGTGSSTGNGPIITGLTILNQTIDICKHHPDLCLNGRCIPT  304
               IP   ++G      G+         +G  +         ID C+  PDLC  G+C+ T
Sbjct  1033  KMIPSLCTHGKCRNTIGS---FKCRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNT  1089

Query  305   LSSYRCECNMGYKQD--SNGDCTDVDECTSNP--CSNGDCVNTPGSYYCKCHAGFQRTPT  360
                + C+C+ GY+       +C D+DEC  +P  C  G C NT GSY C+C  G Q +P 
Sbjct  1090  PGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPN  1149

Query  361   KQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLN  420
               ACIDI+EC  +  LC NGRCVN  G +QC CN G+  T D   CVD DEC+  N    
Sbjct  1150  ISACIDINECELSAHLCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCE  1209

Query  421   GMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTS-GICMNGHCINTEGSFRCECPPGL  479
               C N +GS++C C+PGF L P+ R CTDIDEC+ +  IC  G C N  G +RC C  G 
Sbjct  1210  TFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCYDGF  1269

Query  480   AVGVDGRVCVDTHM----RSTCYGGI---KKGA----CVRPFPGAVTKSECCCANPDYGF  528
                 D + CVD +      + C  G     KG+    C   + G   K+ C   N     
Sbjct  1270  MASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIG  1329

Query  529   GEPC--HPCPAKNSAEFHGLCSSG-IGITVDGRDINECALDPDICS-NGICENLRGSYRC  584
                C  H      +  F   CS G IG  +   D++EC+    +CS +  C+N  GSYRC
Sbjct  1330  AHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRC  1389

Query  585   NCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDI  644
              C  GY  D  G  C D+DECS N  LC NG C N PG Y C C  G+V S +   CEDI
Sbjct  1390  LCKEGYTGD--GFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDI  1447

Query  645   NEC------------------------------------------ESSPCVNGACRNNLG  662
             +EC                                          + + C++G C N  G
Sbjct  1448  DECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISGNCVNTPG  1507

Query  663   SFNCECSPGSKLDSTGLICIDSLKGTCWLNIQ------DSRCEVNINGATLKSECCATLG  716
             S+ C+C P  +L+ T + C+D+  G C+L+I+      D+ C   I     K+ CC +LG
Sbjct  1508  SYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLG  1567

Query  717   AAWGSPCERC------ELDTACSRGFA-RVNGVTC--EDVNECDVFPGVCPNGRCINSRG  767
              AWG+PCE C      E    C  G   R N +T   ED++EC   PG+C  G+CIN+ G
Sbjct  1568  KAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFG  1627

Query  768   SFHCECPEGLTLDGTGRV-----------------------------------------C  786
             SF C CP G  L+   RV                                         C
Sbjct  1628  SFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNC  1687

Query  787   LDIRMEQCYLTW--DEDECIRSVPGKFRMDACCCA--VGAAWGSDCEECPKPDTKEYEAL  842
             +D+R   CY  +  D   C   +        CCC+  +G AW   CE+CP P T E+  L
Sbjct  1688  MDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATL  1747

Query  843   C-PRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEE  901
             C  + PGF    DI TG P   DI+EC+  PG+C NG C N +GSF+C+C  GF  + + 
Sbjct  1748  CGSQRPGFVI--DIYTGLPV--DIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKL  1803

Query  902   RNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCR  961
               C DIDEC   P    +  C+NT GS+ C+C  GY   F     C D +EC+  P +C 
Sbjct  1804  LVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYR--FTSTGQCNDRNECQEIPNICS  1861

Query  962   GGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSG  1021
              G C++T GSF C C  G + +  +  C+D+NEC      C NG C N +G++ C CN G
Sbjct  1862  HGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECER--DACGNGTCRNTIGSFNCRCNHG  1919

Query  1022  YQATPDRRSCTDIDECMIMNGGC--HTHCTNSEGSYECSCSDGYALMPDVRTCADIDECE  1079
             +  + +   C D+DEC   NG    +  C N+ GS++C C++GY + PD RTC DI+EC 
Sbjct  1920  FILSHN-NDCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECL  1978

Query  1080  SNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSF  1139
               P  C  G C N+ G YRC+C  G+  S+  + C D++EC     IC  G C NT+GSF
Sbjct  1979  LEPRKCAPGTCQNLDGSYRCICPPGY--SLQNEKCEDIDECVEEPEICALGTCSNTEGSF  2036

Query  1140  ICHCQLGYSVKKGTTGCTDVD----ECEIGAHNCDMHASCVNVPGSFKCSCR-EGW----  1190
              C C  G+S+      C D+       +     C    S  +      C+ + EGW    
Sbjct  2037  KCLCPEGFSLSSSGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPC  2096

Query  1191  ----------------VGNGI------KCIDLDECSNGTHQCSVNAQCVNSPGSYLCACV  1228
                              G+GI        +D+DEC         + QC+N+ GSY C C 
Sbjct  2097  ELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKE--PDVCKHGQCINTDGSYRCECP  2154

Query  1229  EGFTGDGFTCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINE---  1285
              G+   G  C D DEC+   + C NG C NV G + C CE GF P     +C+DINE   
Sbjct  2155  FGYILAGNECVDTDECSVG-NPCGNGTCKNVIGGFECTCEEGFEPGP-MMTCEDINECAQ  2212

Query  1286  ----CSFQNICVFGT-------------------------------------CNNLPGMF  1304
                 C+F+ +  +G+                                     C NL G +
Sbjct  2213  NPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTY  2272

Query  1305  HCICDDGYELDRTGGNCTDVDEC-ADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCV  1363
              CIC  GY+    G  C D +EC   P  C NG C+NT G Y C C   F  +P    C+
Sbjct  2273  MCICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECL  2332

Query  1364  DNRVGNCYLKYGPRGDGSLSCNTEIGVG----VSRSSCCCSLGKAWGNPCETCPPVNSTE  1419
             DNR G C+ +        L    +IG      V++S CCC  G+ WG  CE CP   +  
Sbjct  2333  DNREGYCFTEV-------LQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVA  2385

Query  1420  YNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETR  1479
             +  LCP G GF  N       DIDEC+ +  +C+ G C+N  GS+ C C  GY       
Sbjct  2386  FKKLCPHGRGFMTNGA-----DIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGT  2440

Query  1480  ICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTS  1539
              C D++EC   P  C    C NT G+Y C CP  Y+    G +C D+ +           
Sbjct  2441  SCVDLNECNQAPKPCN-FICKNTEGSYQCSCPKGYILQEDGRSCKDLDEC----------  2489

Query  1540  CENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVD  1599
                      TK+  C    V       C+ CP              PGFT   H    +D
Sbjct  2490  --------ATKQHNCQFLCVNTIGGFTCK-CP--------------PGFT--QHHTSCID  2524

Query  1600  IDECKEIPGIC-ANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADC  1658
              +EC     +C + G+C N  GSF CEC  GFS +     CED+DEC  G++ CQ    C
Sbjct  2525  NNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQTGSSCEDVDECE-GNHRCQHG--C  2581

Query  1659  INSPGSYRCECAAGF-KLSPNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKAS  1717
              N  G YRC C  G+ +      CVD NECL   ++C    C +  GSYKC+C  GF+  
Sbjct  2582  QNIIGGYRCSCPQGYLQHYQWNQCVDENECLSA-HICGGASCHNTLGSYKCMCPAGFQYE  2640

Query  1718  QDQTMCMDVDEC--ERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCM  1763
             Q    C D++EC   + PC  G C NT G Y C C PG+       C+
Sbjct  2641  QFSGGCQDINECGSAQAPCSYG-CSNTEGGYLCGCPPGYFRIGQGHCV  2687


 Score = 771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 714/2242 (32%), Positives = 969/2242 (43%), Gaps = 380/2242 (17%)

Query  52    CRRGFIPNIRTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDID  111
             C +GF  ++R G C DVDEC+  P  C GG CIN  GSY C+C AG++      +C DID
Sbjct  476   CNKGFQLDLR-GECIDVDECEKNP--CAGGECINNQGSYTCQCRAGYQSTLTRTECRDID  532

Query  112   ECSIIPGICEGSECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQELP  171
             EC     IC    C NT GS+ C+C  G+  + DG  C D    +  +  +NG C  E  
Sbjct  533   ECLQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINE-D  591

Query  172   GRFTKRQCCCESGRCWAMGSVPEMCPVRGSDEYRRLCVDG--APAGGGSR-----GGGTG  224
             G F   +C C+ G  + + S    C      E   +C++G      G  R     G   G
Sbjct  592   GSF---KCICKPG--FQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVG  646

Query  225   GNGFL---PSGNGNGHGHGPRGAGFIPIPGSNGFS------------------PGVGGAG  263
              +G +          +G   RG    P+ G+   S                  P    A 
Sbjct  647   LDGRVCVDTHMRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAE  706

Query  264   VGTGSSTGNGPIITGLTILNQTIDICKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNG-  322
                  S+G      G+T     I+ C   PD+C NG C     +Y+C CN GY+ DS G 
Sbjct  707   YQALCSSG-----PGMTSAGSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGK  761

Query  323   DCTDVDECTSNP--CSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNG  380
             +C D++EC  N   C NG C NTPGS+ C C  GF   P  + C DIDEC      C NG
Sbjct  762   NCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDEC--ESSPCING  819

Query  381   RCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMC-INEDGS----------  429
              C N+ GSF C C++   L      C++  + T     ++G C IN +G+          
Sbjct  820   VCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSL  879

Query  430   ------------FKCICKPGFVLAPNGRYCTDIDECQT-SGICMNGHCINTEGSFRCECP  476
                            IC  G+     G  C DIDEC+   G+C NG C+NT GSF+C+CP
Sbjct  880   GAAWGSPCTLCQVDPICGKGYSRI-KGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCP  938

Query  477   PGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCP  536
              G+ +   GR+C+D  +  TC+   +   C  P  G      CCC+       E C  CP
Sbjct  939   SGMTLDATGRICLDIRLE-TCFLRYEDEECTLPIAGRHRMDACCCSVGAAWGTEECEECP  997

Query  537   AKNSAEFHGLCSSGIGITVDG--------RDINECALDPDICSNGICENLRGSYRCNCNS  588
              +N+ E+  LC  G G             +DINEC + P +C++G C N  GS++C C+S
Sbjct  998   MRNTPEYEELCPRGPGFATKEITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDS  1057

Query  589   GYEPDPSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFS-TETDTCEDINEC  647
             G+  D   RNC DIDEC ++  LC  G C NTPG + C C +GY         C DI+EC
Sbjct  1058  GFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDEC  1117

Query  648   ESSP--CVNGACRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVNINGA  705
             +  P  C  G C N  GS+ CEC PG +L      CID                  IN  
Sbjct  1118  QRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISACID------------------INEC  1159

Query  706   TLKSECCATLGAAWGSPCERC-----ELDTACSRGFARV-NGVTCEDVNECDVFPGVCPN  759
              L +  C         P  RC     +   AC+ G+    + + C D++EC +  G C  
Sbjct  1160  ELSAHLC---------PNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCET  1210

Query  760   GRCINSRGSFHCECPEGLTLDGTGRVCLDI-RMEQCYLTWDEDECIRSVPGKFRMDACCC  818
               C NS GS+ C C  G  L    R C DI   E      D  +C  ++PG++R   C C
Sbjct  1211  -FCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCT-NIPGEYR---CLC  1265

Query  819   AVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNG  878
               G     D + C                                D+NEC + P +C++G
Sbjct  1266  YDGFMASEDMKTC-------------------------------VDVNECDLNPNICLSG  1294

Query  879   KCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGS-GTCVNTPGSFECECFDGY  937
              C NT GSF C C+ G++    +  CTDI+EC I    CG    C NT GSF+C C  G+
Sbjct  1295  TCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGW  1354

Query  938   ESGFMMMKNCMDIDECERNPLLC-RGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECS  996
                 +    C D+DEC     +C +   C NT GS++C C  G+  +     C D++ECS
Sbjct  1355  IGDGI---KCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGY--TGDGFTCTDLDECS  1409

Query  997   LSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYE  1056
              + +LC NG+C+N  G Y+C C+ G+  + D ++C DIDEC + N      C N  G + 
Sbjct  1410  ENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGLFR  1469

Query  1057  CSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCID  1116
             C C  GY L      C D++EC  +P  C  G C N PG Y C C   F  +     C+D
Sbjct  1470  CECEIGYELDRSGGNCTDVNEC-LDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVD  1528

Query  1117  VNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCV  1176
                 +   +I   G+     G   C  ++G  V K +  C+     +     C+M  +  
Sbjct  1529  TRSGNCYLDIRPRGD----NGDTACSNEIGVGVSKASCCCSLG---KAWGTPCEMCPAVN  1581

Query  1177  NVPGSFKCSCREGWVGNGIKCI--DLDECSNGTHQCSVNAQCVNSPGSYLCACVEGF--T  1232
                    C   EG+  N I  I  D+DEC      C    +C+N+ GS+ C C  G+   
Sbjct  1582  TSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQ-GGKCINTFGSFQCRCPTGYYLN  1640

Query  1233  GDGFTCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINE-------  1285
              D   C DV+EC E   +C  G C N  G Y C C   +   +   +C D+         
Sbjct  1641  EDTRVCDDVNEC-ETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNY  1699

Query  1286  ---------------------CSFQNICVFGTCNNLP---------GMFHCICDD---GY  1312
                                  CS+      G   N P           F  +C     G+
Sbjct  1700  YADNQTCDGELLFNMTKKMCCCSYN----IGRAWNKPCEQCPIPSTDEFATLCGSQRPGF  1755

Query  1313  ELDRTGGNCTDVDECAD-PINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVD-------  1364
              +D   G   D+DEC + P  C NG+C+N  G + C CP  F  N   + C D       
Sbjct  1756  VIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNG  1815

Query  1365  ----------NRVGN--CYLKYGPRGDGSLSCN-----TEIGVGVSRSSCCCSLGKAW--  1405
                       N  G+  C  K G R   +  CN      EI    S   C  ++G  +  
Sbjct  1816  PVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCL  1875

Query  1406  ----------------GNPCETCPPVNSTEYNTLCPGGEGFRPNPITIILE-----DIDE  1444
                              N CE     N T  NT+  G    R N   I+       D+DE
Sbjct  1876  CHTGFKTNDDQTMCLDINECERDACGNGTCRNTI--GSFNCRCNHGFILSHNNDCIDVDE  1933

Query  1445  CQELPG-LCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTL  1503
             C    G LC+ G CINT GSFQC+C +GY ++ + R C DI+EC+  P  C PGTC N  
Sbjct  1934  CASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAPGTCQNLD  1993

Query  1504  GNYTCICPPEYMQVN----------------------------------------GGHNC  1523
             G+Y CICPP Y   N                                         G  C
Sbjct  1994  GSYRCICPPGYSLQNEKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSSGRRC  2053

Query  1524  MDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICG  1583
              D+R S+CY  + G  C +    N +K+ CCC    G+ W  PCE CPT     F+ IC 
Sbjct  2054  QDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALK-GEGWGDPCELCPTEPDEAFRQICP  2112

Query  1584  NIPGFTFDIHSGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDID  1643
                G         AVD+DECKE P +C +G CIN  GS+RCECP  F Y      C D D
Sbjct  2113  YGSGIIVGPDD-SAVDMDECKE-PDVCKHGQCINTDGSYRCECP--FGYILAGNECVDTD  2168

Query  1644  ECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDMQ  1703
             ECS G N C  N  C N  G + C C  GF+  P   C D NEC + P +C+   CV+  
Sbjct  2169  ECSVG-NPCG-NGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAF-RCVNTY  2225

Query  1704  GSYKCICHNGFKASQDQTMCMDVDECE--RHPCGNGT--CKNTVGSYNCLCYPGFELTHN  1759
             GSY+C C  G+   +D+ MC D DECE  +H C      CKN +G+Y C+C PG++   +
Sbjct  2226  GSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPD  2285

Query  1760  ND-CMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNE----CVAL  1814
              + C+D +EC +  G +C NGRC N  GS+ C CN+G+  + +   C+D  E       L
Sbjct  2286  GEGCVDENECQTKPG-ICENGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVL  2344

Query  1815  PGSCSPGT------------CQNLEG--------------SFRCICPPGYEVKSESCIDI  1848
                C  G+            C    G              +F+ +CP G    +    DI
Sbjct  2345  QNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNG-ADI  2403

Query  1849  NECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQ--------SFCFTNFE  1900
             +EC    ++C  G C N  G + CIC TG+     G  C D  +        +F   N E
Sbjct  2404  DECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQAPKPCNFICKNTE  2463

Query  1901  NG-KCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTI---PGI  1956
                +CS PK +   +         G    D  E   K+    F  +   G  T    PG 
Sbjct  2464  GSYQCSCPKGYILQED--------GRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGF  2515

Query  1957  DDTRE---DVNECLESPGVC-SNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGN  2012
                     D NEC     +C S G C NT GSF CEC  G++LD TG  C D DEC   +
Sbjct  2516  TQHHTSCIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQTGSSCEDVDECEGNH  2575

Query  2013  PCGNGTCTNVIGSFECNCHEGF  2034
              C +G C N+IG + C+C +G+
Sbjct  2576  RCQHG-CQNIIGGYRCSCPQGY  2596


 Score = 755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 667/2152 (31%), Positives = 934/2152 (43%), Gaps = 400/2152 (19%)

Query  7     CFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNI--RTGA  64
             C+       C   L G V     CCA+   A+G PC+ CPAQ     +    +    T A
Sbjct  661   CYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSA  720

Query  65    CQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICEGSE  124
               D++EC   P +C  G C N  G+Y+C C +G++ +   + C DI+EC +   +C+  +
Sbjct  721   GSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQ  780

Query  125   CSNTVGSYFCICPRGYVTSTD---------------------------------------  145
             C NT GS+ C CP+G++   D                                       
Sbjct  781   CRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESSPCINGVCKNSPGSFICECSSESTLDP  840

Query  146   -GSRCIDQRASTCFSNIVNGRCAQELPGRFTKRQCCCESGRCWAMGSVPEMCPVRGSDEY  204
               + CI+    TC+  +++GRC   + G   K QCC   G  W  GS   +C V      
Sbjct  841   TKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAW--GSPCTLCQV------  892

Query  205   RRLCVDGAPAGGGSRGGGTGGNGFLPSGNGNGHGHGPRGAGFIPIPGSNGFSPGVGGAGV  264
               +C  G     G++          P    NG     RG+     P              
Sbjct  893   DPICGKGYSRIKGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCP--------------  938

Query  265   GTGSSTGNGPIITGLTILNQTIDIC--KHHPDLCLNGRCIPTLSSYR---CECNMGYKQD  319
                  +G     TG   L+  ++ C  ++  + C     +P    +R   C C++G    
Sbjct  939   -----SGMTLDATGRICLDIRLETCFLRYEDEECT----LPIAGRHRMDACCCSVGAAWG  989

Query  320   SNGDCTDVDECTSNPCSNGD-----CVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNG  374
             +       +EC   P  N       C   PG       A  + T  K    DI+EC    
Sbjct  990   T-------EECEECPMRNTPEYEELCPRGPG------FATKEITNGKPFFKDINECKMIP  1036

Query  375   VLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTT-NMCLNGMCINEDGSFKCI  433
              LC +G+C NT GSF+C C++GF L ++ +NC D DEC  + ++C  G C+N  G F+C 
Sbjct  1037  SLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECK  1096

Query  434   C----KPGFVLAPNGRYCTDIDECQTSG-ICMNGHCINTEGSFRCECPPGLAVGVDGRVC  488
             C    + GF++  N   C DIDECQ    +C  G C NTEGS+RCECPPG  +  +   C
Sbjct  1097  CDEGYESGFMMMKN---CMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISAC  1153

Query  489   VDTHMRSTCYGGIKKGACVRPFPGAVTKSECCC-----ANPDYGFGEPCHPCPAKN----  539
             +D +           G CV      + K +C C     + PD  F      C   N    
Sbjct  1154  IDINECELSAHLCPNGRCVN----LIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCE  1209

Query  540   ------SAEFHGLCSSGIGITVDGR---DINECALDPDICSNGICENLRGSYRCNCNSGY  590
                      +   C  G  +  D R   DI+EC  +P+IC  G C N+ G YRC C  G+
Sbjct  1210  TFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCYDGF  1269

Query  591   EPDPSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINECESS  650
                   + CVD++EC +N  +C +G C NT GS+ C C  GY        C DINECE  
Sbjct  1270  MASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIG  1329

Query  651   PC---VNGACRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVNINGA--  705
                   +  C N  GSF C CSPG   D      +D       +  Q + C+  +     
Sbjct  1330  AHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRC  1389

Query  706   -------------TLKSECCATLGAAWGSPC------ERCELDTACSRGFA-RVNGVTCE  745
                          T   EC   L       C       RCE    C  GF    +G  CE
Sbjct  1390  LCKEGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCE----CDMGFVPSADGKACE  1445

Query  746   DVNECDV-----------FPGV-----------------------------CPNGRCINS  765
             D++EC +            PG+                             C +G C+N+
Sbjct  1446  DIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISGNCVNT  1505

Query  766   RGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWD------EDECIRSVPGKFRMDACCCA  819
              GS+ C+CP    L+ T   C+D R   CYL         +  C   +       +CCC+
Sbjct  1506  PGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCS  1565

Query  820   VGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNGK  879
             +G AWG+ CE CP  +T EY+ LCP G GF  R + +T     +DI+EC+  PG+C  GK
Sbjct  1566  LGKAWGTPCEMCPAVNTSEYKILCPGGEGF--RPNPIT--VILEDIDECQELPGLCQGGK  1621

Query  880   CRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYES  939
             C NT GSF+C+C +G+ L+ + R C D++EC  +P +CG GTC NT G++ C C   Y  
Sbjct  1622  CINTFGSFQCRCPTGYYLNEDTRVCDDVNECE-TPGICGPGTCYNTVGNYTCICPPDYMQ  1680

Query  940   GFMMMKNCMDIDE--CERNPLL----CRGGTCVN-TEGSFQCDCPLGHELSPSREEC---  989
                   NCMD+    C RN       C G    N T+    C   +G   +   E+C   
Sbjct  1681  -VNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIP  1739

Query  990   -------------------------IDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQA  1024
                                      +D++EC     +C NG C+NMVG+++C C  G+  
Sbjct  1740  STDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFY  1799

Query  1025  TPDRRSCTDIDECMIMNGGC---HTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESN  1081
                   C DIDEC   NG     +  C N+ GSY C C  GY        C D +EC+  
Sbjct  1800  NDKLLVCEDIDEC--QNGPVCQRNAECINTAGSYRCDCKPGYRFT-STGQCNDRNECQEI  1856

Query  1082  PDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFIC  1141
             P+IC  GQC +  G + CLC+ GF  + D   C+D+NEC+ ++  C  G C NT GSF C
Sbjct  1857  PNICSHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERDA--CGNGTCRNTIGSFNC  1914

Query  1142  HCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGW--VGNGIKCID  1199
              C  G+ +      C DVDEC  G  N   +  C+N  GSF+C C EG+    +G  C+D
Sbjct  1915  RCNHGF-ILSHNNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVD  1973

Query  1200  LDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECAENVHLCENGQCLNV  1259
             ++EC     +C+    C N  GSY C C  G++     C D+DEC E   +C  G C N 
Sbjct  1974  INECLLEPRKCAP-GTCQNLDGSYRCICPPGYSLQNEKCEDIDECVEEPEICALGTCSNT  2032

Query  1260  PGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFH----CIC-------  1308
              G+++C C  GF+ +S  + CQD+           G C++     H    C C       
Sbjct  2033  EGSFKCLCPEGFSLSSSGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGW  2092

Query  1309  -----------DDGYE---------LDRTGGNCTDVDECADPINCVNGLCVNTPGRYECN  1348
                        D+ +          +     +  D+DEC +P  C +G C+NT G Y C 
Sbjct  2093  GDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCE  2152

Query  1349  CPPDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNP  1408
             CP  + L   G  CVD                                  CS+G   GN 
Sbjct  2153  CPFGYIL--AGNECVDTDE-------------------------------CSVGNPCGN-  2178

Query  1409  CETCPPVNSTEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCEC  1468
               TC  V        C   EGF P P+ +  EDI+EC + P LC    C+NT+GS++C+C
Sbjct  2179  -GTCKNVIG---GFECTCEEGFEPGPM-MTCEDINECAQNPLLC-AFRCVNTYGSYECKC  2232

Query  1469  PKGYYLSEETRICEDID-------------------------------------------  1485
             P GY L E+ R+C+D D                                           
Sbjct  2233  PVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCVDE  2292

Query  1486  -ECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCE---  1541
              EC   PG+C  G C NT G+YTC C   +        C+D R+ +C+       C+   
Sbjct  2293  NECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVLQNMCQIGS  2352

Query  1542  -NELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDI  1600
              N  P  VTK  CCC  + G+ W   CE CP  GT  FK +C +  GF  +       DI
Sbjct  2353  SNRNP--VTKSECCC--DGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTN-----GADI  2403

Query  1601  DECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCIN  1660
             DECK I  +C NG C+N  GS+ C C TG++ +     C D++EC+     C  N  C N
Sbjct  2404  DECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQAPKPC--NFICKN  2461

Query  1661  SPGSYRCECAAGFKLSPNG-ACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQD  1719
             + GSY+C C  G+ L  +G +C D +EC    + C   LCV+  G + C C  GF  +Q 
Sbjct  2462  TEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQF-LCVNTIGGFTCKCPPGF--TQH  2518

Query  1720  QTMCMDVDEC--ERHPCGN-GTCKNTVGSYNCLCYPGFELTHN-NDCMDIDECSSFFGQV  1775
              T C+D +EC  + + CG+ G C+NT GS+ C C  GF L    + C D+DEC       
Sbjct  2519  HTSCIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQTGSSCEDVDECEG--NHR  2576

Query  1776  CRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICP  1835
             C++G C N IG ++C C +GY        C+D NEC++    C   +C N  GS++C+CP
Sbjct  2577  CQHG-CQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSA-HICGGASCHNTLGSYKCMCP  2634

Query  1836  PG--YEVKSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGR  1885
              G  YE  S  C DINEC      C +G C+NT GG+ C CP G+     G 
Sbjct  2635  AGFQYEQFSGGCQDINECGSAQAPCSYG-CSNTEGGYLCGCPPGYFRIGQGH  2685


 Score = 741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 654/1950 (34%), Positives = 891/1950 (46%), Gaps = 389/1950 (20%)

Query  284   QTIDICKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNG-DCTDVDECT-SNPCSNGDCV  341
             + ID C  +  +C NGRCI T  S+ C CN G+    +G +C D+DEC+  N C NG C+
Sbjct  529   RDIDECLQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCI  588

Query  342   NTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTT  401
             N  GS+ C C  GFQ     + C DI+EC   G+ C NGRCVNTDGS++C C  G  +  
Sbjct  589   NEDGSFKCICKPGFQLASDGRYCKDINECETPGI-CMNGRCVNTDGSYRCECFPGLAVGL  647

Query  402   DGKNCVD-HDECTTTNMCLNGMCI------------------------------NEDGSF  430
             DG+ CVD H   T       G CI                                   +
Sbjct  648   DGRVCVDTHMRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEY  707

Query  431   KCICKPGFVLAPNGRYCTDIDECQTS-GICMNGHCINTEGSFRCECPPGLAVGVDGRVCV  489
             + +C  G  +   G   +DI+EC     IC NG C N  G+++C C  G  V   G+ CV
Sbjct  708   QALCSSGPGMTSAG---SDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCV  764

Query  490   DTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGLCSS  549
             D +           G C R  PG+                             F   C  
Sbjct  765   DINECVLNSLLCDNGQC-RNTPGS-----------------------------FVCTCPK  794

Query  550   GIGITVDGR---DINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVD-----  601
             G     D +   DI+EC   P  C NG+C+N  GS+ C C+S    DP+   C++     
Sbjct  795   GFIYKPDLKTCEDIDECESSP--CINGVCKNSPGSFICECSSESTLDPTKTICIETIKGT  852

Query  602   -----ID---ECSVNRLLCDNGLCRNTPGSYS--CT-------CPKGYVFSTETDTCEDI  644
                  ID   E ++N     +  C +   ++   CT       C KGY     T  CEDI
Sbjct  853   CWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGYSRIKGTQ-CEDI  911

Query  645   NECESSP--CVNGACRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVNI  702
             +ECE  P  C NG C N  GSF C+C  G  LD+TG IC+D    TC+L  +D  C + I
Sbjct  912   DECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLDATGRICLDIRLETCFLRYEDEECTLPI  971

Query  703   NGATLKSECCATLGAAWGS-PCERC------ELDTACSR--GFAR---VNGVT-CEDVNE  749
              G      CC ++GAAWG+  CE C      E +  C R  GFA     NG    +D+NE
Sbjct  972   AGRHRMDACCCSVGAAWGTEECEECPMRNTPEYEELCPRGPGFATKEITNGKPFFKDINE  1031

Query  750   CDVFPGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDI---RME-------QCYLT--  797
             C + P +C +G+C N+ GSF C C  G  LD   R C DI   R+        QC  T  
Sbjct  1032  CKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPG  1091

Query  798   --------------------WDEDECIR-----------SVPGKFRMDACCCAVGAAWGS  826
                                  D DEC R           +  G +R   C C  G     
Sbjct  1092  DFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYR---CECPPGHQLSP  1148

Query  827   DCEECPKPDTKEYEA-LCPRG--------------PGFSNRGDILTGRPFYKDINECKVF  871
             +   C   +  E  A LCP G              PG+ +  D    R F  DI+EC + 
Sbjct  1149  NISACIDINECELSAHLCPNGRCVNLIGKYQCACNPGYHSTPD----RLFCVDIDECSIM  1204

Query  872   PGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFEC  931
              G C    C N+ GS++C C  GF L  ++R+CTDIDEC  +P++C  G C N PG + C
Sbjct  1205  NGGCET-FCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRC  1263

Query  932   ECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECID  991
              C+DG+ +    MK C+D++EC+ NP +C  GTC NT+GSF C C +G+     +  C D
Sbjct  1264  LCYDGFMAS-EDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTD  1322

Query  992   VNECSLSDSLC-RNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGC--HTHC  1048
             +NEC +    C ++  C N  G+++CSC+ G+    D   CTD+DEC      C  H  C
Sbjct  1323  INECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIG--DGIKCTDLDECSNGTHMCSQHADC  1380

Query  1049  TNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMAS  1108
              N+ GSY C C +GY    D  TC D+DEC  N ++C  GQC N PG YRC C  GF+ S
Sbjct  1381  KNTMGSYRCLCKEGYT--GDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPS  1438

Query  1109  MDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHN  1168
              D K C D++EC L  NIC+FG C N  G F C C++GY + +    CTDV+EC +    
Sbjct  1439  ADGKACEDIDECSL-PNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNEC-LDPTT  1496

Query  1169  CDMHASCVNVPGSFKCSCREGWVGNGIK--CID-------LD----------ECSNGTHQ  1209
             C +  +CVN PGS+ C C   +  N  +  C+D       LD           CSN    
Sbjct  1497  C-ISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGV  1555

Query  1210  CSVNAQCVNSPG------------------SYLCACVEGFTGDGFTC--SDVDECAENVH  1249
                 A C  S G                    LC   EGF  +  T    D+DEC E   
Sbjct  1556  GVSKASCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPG  1615

Query  1250  LCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICD  1309
             LC+ G+C+N  G+++C C  G+    D++ C D+NEC    IC  GTC N  G + CIC 
Sbjct  1616  LCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICP  1675

Query  1310  DGYELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGN  1369
               Y +   GGN                                         C+D R   
Sbjct  1676  PDY-MQVNGGN----------------------------------------NCMDMRRSL  1694

Query  1370  CYLKYGPRGDGSLSCNTEIGVGVSRSSCCCS--LGKAWGNPCETCPPVNSTEYNTLCPGG  1427
             CY  Y      + +C+ E+   +++  CCCS  +G+AW  PCE CP  ++ E+ TLC   
Sbjct  1695  CYRNYYA---DNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQ  1751

Query  1428  E-GFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDE  1486
               GF  +  T +  DIDEC+E+PG+C+ G CIN  GSF+CECP G++ +++  +CEDIDE
Sbjct  1752  RPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDE  1811

Query  1487  CVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPF  1546
             C   P       C NT G+Y C C P Y   + G  C D  +              E+P 
Sbjct  1812  CQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQ-CNDRNEC------------QEIPN  1858

Query  1547  NVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEI  1606
               +   C  T                     F  +C    GF  +      +DI+EC+  
Sbjct  1859  ICSHGQCIDT------------------VGSFYCLCHT--GFKTNDDQTMCLDINECER-  1897

Query  1607  PGICANGVCINQIGSFRCECPTGF--SYNDLLLVCEDIDECSNGD-NLCQRNADCINSPG  1663
                C NG C N IGSF C C  GF  S+N+    C D+DEC++G+ NLC RN  CIN+ G
Sbjct  1898  -DACGNGTCRNTIGSFNCRCNHGFILSHNN---DCIDVDECASGNGNLC-RNGQCINTVG  1952

Query  1664  SYRCECAAGFKLSPNG-ACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTM  1722
             S++C+C  G++++P+G  CVD NECL  P  C+ G C ++ GSY+CIC  G+    ++  
Sbjct  1953  SFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAPGTCQNLDGSYRCICPPGYSLQNEK--  2010

Query  1723  CMDVDECERHP--CGNGTCKNTVGSYNCLCYPGFELTHN-NDCMDIDECSSFFGQVCRNG  1779
             C D+DEC   P  C  GTC NT GS+ CLC  GF L+ +   C D+           R  
Sbjct  2011  CEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSSGRRCQDL-----------RMS  2059

Query  1780  RCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQ----NLEGSFRCICP  1835
              C+ +    KC        +   +N      C AL G      C+      + +FR ICP
Sbjct  2060  YCYAKFEGGKC-------SSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICP  2112

Query  1836  PGYEV---KSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQ  1892
              G  +     +S +D++EC E P++C  G C NT G ++C CP G++L+  G  C DT +
Sbjct  2113  YGSGIIVGPDDSAVDMDECKE-PDVCKHGQCINTDGSYRCECPFGYILA--GNECVDTDE  2169

Query  1893  SFCFTNFENGKC-SVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHG  1951
                     NG C +V   F  T                 CE                  G
Sbjct  2170  CSVGNPCGNGTCKNVIGGFECT-----------------CE-----------------EG  2195

Query  1952  TIPGIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIG  2011
               PG   T ED+NEC ++P +C+   C+NT GS+ C+CP+GY L      C D DEC  G
Sbjct  2196  FEPGPMMTCEDINECAQNPLLCAF-RCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEG  2254

Query  2012  N---PCGNGTCTNVIGSFECNCHEGFEPGP  2038
                       C N+IG++ C C  G++  P
Sbjct  2255  KHDCTEKQMECKNLIGTYMCICGPGYQRRP  2284


 Score = 666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/1574 (33%), Positives = 712/1574 (45%), Gaps = 305/1574 (19%)

Query  683   DSLKGTCWLNIQDSRCEVNINGAT-LKSECCATLGAAWGSPCERCELD-TACSRGFA---  737
             D   G C+  I +  C+  ++G    K+ CCAT+G AWG PCE C      C RGF    
Sbjct  180   DYRTGPCFTVISNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNI  239

Query  738   --------------------------------------RVNGVT--CEDVNECDVFPGVC  757
                                                   ++N V+  CED++EC   PG+C
Sbjct  240   RTGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKLNEVSQKCEDIDECSTIPGIC  299

Query  758   PNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRMDACC  817
               G C N+  S+ C+CP G      G  C+D+R   CY       C   +P       CC
Sbjct  300   EGGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALTNGRCSNQLPQSITKMQCC  359

Query  818   CAVGAAWGSDC----EECPKPDTKEYEALC------------------------------  843
             C  G  W        E CP   T+++  LC                              
Sbjct  360   CDAGRCWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRPEYPPPPLGPIPPVLPVPPGF  419

Query  844   --------PRGPGFSNRGDILTGRPFYKDINE-CKVFPGMCMNGKCRNTIGSFKCKCNSG  894
                     PR P           R    ++ + C++   +C NG+C  T GS +C+CN G
Sbjct  420   PPGPQIPVPRPPVEYLYPSREPPRVLPVNVTDYCQLVRYLCQNGRCIPTPGSCRCECNKG  479

Query  895   FTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECE  954
             F LD+    C D+DEC  +P  C  G C+N  GS+ C+C  GY+S     + C DIDEC 
Sbjct  480   FQLDLRGE-CIDVDECEKNP--CAGGECINNQGSYTCQCRAGYQSTLTRTE-CRDIDECL  535

Query  955   RNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTY  1014
             +N  +C  G C+NT+GSF C C  G  ++   + C D++ECS+ + +C NG C+N  G++
Sbjct  536   QNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRN-MCLNGMCINEDGSF  594

Query  1015  QCSCNSGYQATPDRRSCTDIDEC----MIMNGGCHTHCTNSEGSYECSCSDGYALMPDVR  1070
             +C C  G+Q   D R C DI+EC    + MNG     C N++GSY C C  G A+  D R
Sbjct  595   KCICKPGFQLASDGRYCKDINECETPGICMNG----RCVNTDGSYRCECFPGLAVGLDGR  650

Query  1071  TCADIDE--------------------------CESNPDICDGGQCTNIP----GEYRCL  1100
              C D                             C ++ +   G  C   P     EY+ L
Sbjct  651   VCVDTHMRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQAL  710

Query  1101  CYDG-FMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDV  1159
             C  G  M S       D+NEC L+ +IC  G CEN +G++ C C  GY V      C D+
Sbjct  711   CSSGPGMTSAGS----DINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDI  766

Query  1160  DECEIGAHNCDMHASCVNVPGSFKCSCREGWV--GNGIKCIDLDECSNGTHQCSVNAQCV  1217
             +EC + +  CD +  C N PGSF C+C +G++   +   C D+DEC +      +N  C 
Sbjct  767   NECVLNSLLCD-NGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESSP---CINGVCK  822

Query  1218  NSPGSYLCACVEGFTGDGFTCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASDS  1277
             NSPGS++C C    T D         C E +     G C       R  CE+    A+  
Sbjct  823   NSPGSFICECSSESTLD----PTKTICIETI----KGTCWQTVIDGR--CEININGATLK  872

Query  1278  KSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDEC-ADPINCVNG  1336
               C      ++ + C    C   P     IC  GY   + G  C D+DEC   P  C NG
Sbjct  873   SQCCSSLGAAWGSPCTL--CQVDP-----ICGKGYSRIK-GTQCEDIDECEVFPGVCKNG  924

Query  1337  LCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSS  1396
             LCVNT G ++C CP    L+ TG  C+D R+  C+L+Y         C   I       +
Sbjct  925   LCVNTRGSFKCQCPSGMTLDATGRICLDIRLETCFLRYEDE-----ECTLPIAGRHRMDA  979

Query  1397  CCCSLGKAWGN-PCETCPPVNSTEYNTLCPGGEGFRPNPIT---IILEDIDECQELPGLC  1452
             CCCS+G AWG   CE CP  N+ EY  LCP G GF    IT      +DI+EC+ +P LC
Sbjct  980   CCCSVGAAWGTEECEECPMRNTPEYEELCPRGPGFATKEITNGKPFFKDINECKMIPSLC  1039

Query  1453  QGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPP  1512
               G C NT GSF+C C  G+ L  E R C DIDEC   P +CG G C NT G++ C C  
Sbjct  1040  THGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECKCDE  1099

Query  1513  EYMQ-VNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCP  1571
              Y        NCMD+ +  C R           P      +C   +N   ++   CE CP
Sbjct  1100  GYESGFMMMKNCMDIDE--CQRD----------PLLCRGGVC---HNTEGSYR--CE-CP  1141

Query  1572  TPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFS  1631
                           PG     +    +DI+EC+    +C NG C+N IG ++C C  G+ 
Sbjct  1142  --------------PGHQLSPNISACIDINECELSAHLCPNGRCVNLIGKYQCACNPGYH  1187

Query  1632  YNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNG-ACVDRNECLEI  1690
                  L C DIDECS  +  C+    C NS GSY C C  GF L P+  +C D +EC + 
Sbjct  1188  STPDRLFCVDIDECSIMNGGCE--TFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDN  1245

Query  1691  PNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHP--CGNGTCKNTVGSYNC  1748
             PN+C  G C ++ G Y+C+C++GF AS+D   C+DV+EC+ +P  C +GTC+NT GS+ C
Sbjct  1246  PNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFIC  1305

Query  1749  LCYPGF---------------ELTHNN---------------------------DCMDID  1766
              C  G+               E+  +N                            C D+D
Sbjct  1306  HCDMGYSGKKGKTGCTDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDLD  1365

Query  1767  ECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECV--------------  1812
             ECS+      ++  C N +GS++CLC EGY  T DG  C D +EC               
Sbjct  1366  ECSNGTHMCSQHADCKNTMGSYRCLCKEGY--TGDGFTCTDLDECSENLNLCGNGQCLNA  1423

Query  1813  ---------------------------ALPGSCSPGTCQNLEGSFRCICPPGYEVKSE--  1843
                                        +LP  C  GTC NL G FRC C  GYE+     
Sbjct  1424  PGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGG  1483

Query  1844  SCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNF----  1899
             +C D+NEC  DP  C+ G+C NTPG + C CP  F L+     C DTR   C+ +     
Sbjct  1484  NCTDVNEC-LDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRG  1542

Query  1900  ENG--KCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPG-I  1956
             +NG   CS       +KA CCCS   G+ WG PCE+CP      ++ LCP G G  P  I
Sbjct  1543  DNGDTACSNEIGVGVSKASCCCSL--GKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPI  1600

Query  1957  DDTREDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGN  2016
                 ED++EC E PG+C  G CINT GSF+C CP GY L+     C D +EC     CG 
Sbjct  1601  TVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGP  1660

Query  2017  GTCTNVIGSFECNC  2030
             GTC N +G++ C C
Sbjct  1661  GTCYNTVGNYTCIC  1674


 Score = 641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/1856 (31%), Positives = 812/1856 (44%), Gaps = 352/1856 (19%)

Query  326   DVDECTSNP--CSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCV  383
             D++EC   P  C++G C NT GS+ C+C +GF     ++ C DIDEC  +  LC  G+CV
Sbjct  1028  DINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCGRGQCV  1087

Query  384   NTDGSFQCICNAGFEL-TTDGKNCVDHDECTTTNM-CLNGMCINEDGSFKCICKPGFVLA  441
             NT G F+C C+ G+E      KNC+D DEC    + C  G+C N +GS++C C PG  L+
Sbjct  1088  NTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLS  1147

Query  442   PNGRYCTDIDECQTSG-ICMNGHCINTEGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGG  500
             PN   C DI+EC+ S  +C NG C+N  G ++C C PG     D   CVD    S   GG
Sbjct  1148  PNISACIDINECELSAHLCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGG  1207

Query  501   IKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGLCSSGIGITVDGR--  558
                              E  C N +  +   C P               G  +  D R  
Sbjct  1208  C----------------ETFCTNSEGSYECSCQP---------------GFALMPDQRSC  1236

Query  559   -DINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLC  617
              DI+EC  +P+IC  G C N+ G YRC C  G+      + CVD++EC +N  +C +G C
Sbjct  1237  TDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTC  1296

Query  618   RNTPGSYSCTCPKGYVFSTETDTCEDINECESSPC---VNGACRNNLGSFNCECSPGSKL  674
              NT GS+ C C  GY        C DINECE        +  C N  GSF C CSPG   
Sbjct  1297  ENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIG  1356

Query  675   DSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACSR  734
             D  G+ C D              C    +  +  ++C  T+G+       RC     C  
Sbjct  1357  D--GIKCTDL-----------DECSNGTHMCSQHADCKNTMGSY------RC----LCKE  1393

Query  735   GFARVNGVTCEDVNECDVFPGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQC  794
             G+   +G TC D++EC     +C NG+C+N+ G + CEC  G      G+ C DI  ++C
Sbjct  1394  GYTG-DGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDI--DEC  1450

Query  795   YLTWDEDECI----RSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFS  850
              L    + C+     ++PG FR   C C +G         C                   
Sbjct  1451  SLP---NICVFGTCHNLPGLFR---CECEIGYELDRSGGNC-------------------  1485

Query  851   NRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTD----  906
                          D+NEC + P  C++G C NT GS+ C C   F L+     C D    
Sbjct  1486  ------------TDVNEC-LDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSG  1532

Query  907   ---------------------------------IDECWISP-DLCGSGTCVNTPG-SFEC  931
                                              + + W +P ++C +   VNT      C
Sbjct  1533  NCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCPA---VNTSEYKILC  1589

Query  932   ECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECID  991
                +G+    + +    DIDEC+  P LC+GG C+NT GSFQC CP G+ L+     C D
Sbjct  1590  PGGEGFRPNPITVI-LEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDD  1648

Query  992   VNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIM------NGGCH  1045
             VNEC  +  +C  G C N VG Y C C   Y       +C D+   +        N  C 
Sbjct  1649  VNECE-TPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCD  1707

Query  1046  THCTNSEGSYECSCS-------------------DGYA---------LMPDVRTC--ADI  1075
                  +     C CS                   D +A          + D+ T    DI
Sbjct  1708  GELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDI  1767

Query  1076  DECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMF-GECEN  1134
             DEC   P +C+ G C N+ G +RC C  GF  +  +  C D++EC  N  +C    EC N
Sbjct  1768  DECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQ-NGPVCQRNAECIN  1826

Query  1135  TKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNG  1194
             T GS+ C C+ GY     T  C D +EC+   + C  H  C++  GSF C C  G+  N 
Sbjct  1827  TAGSYRCDCKPGYRFTS-TGQCNDRNECQEIPNICS-HGQCIDTVGSFYCLCHTGFKTND  1884

Query  1195  --IKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFT-GDGFTCSDVDECAE-NVHL  1250
                 C+D++EC         N  C N+ GS+ C C  GF       C DVDECA  N +L
Sbjct  1885  DQTMCLDINECE---RDACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECASGNGNL  1941

Query  1251  CENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQ-NICVFGTCNNLPGMFHCICD  1309
             C NGQC+N  G+++C+C  G+  A D ++C DINEC  +   C  GTC NL G + CIC 
Sbjct  1942  CRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAPGTCQNLDGSYRCICP  2001

Query  1310  DGYELDRTGGNCTDVDECAD-PINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVG  1368
              GY L      C D+DEC + P  C  G C NT G ++C CP  F L+ +G  C D R+ 
Sbjct  2002  PGYSLQNE--KCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSSGRRCQDLRMS  2059

Query  1369  NCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSL-GKAWGNPCETCPPVNSTEYNTLCPGG  1427
              CY K+    +G   C++      S+  CCC+L G+ WG+PCE CP      +  +CP G
Sbjct  2060  YCYAKF----EGG-KCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYG  2114

Query  1428  EGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDEC  1487
              G    P    + D+DEC+                                         
Sbjct  2115  SGIIVGPDDSAV-DMDECK-----------------------------------------  2132

Query  1488  VAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFN  1547
                P VC  G C NT G+Y C CP  Y+    G+ C+D  +          +C+N     
Sbjct  2133  --EPDVCKHGQCINTDGSYRCECPFGYILA--GNECVDTDECSVGNPCGNGTCKN-----  2183

Query  1548  VTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIP  1607
                        V   +   CE    PG           P  T +       DI+EC + P
Sbjct  2184  -----------VIGGFECTCEEGFEPG-----------PMMTCE-------DINECAQNP  2214

Query  1608  GICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLC-QRNADCINSPGSYR  1666
              +CA   C+N  GS+ C+CP G+   +   +C+D DEC  G + C ++  +C N  G+Y 
Sbjct  2215  LLCAF-RCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYM  2273

Query  1667  CECAAGFKLSPNG-ACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMD  1725
             C C  G++  P+G  CVD NEC   P +C +G C++ +GSY C C++GF AS +Q  C+D
Sbjct  2274  CICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLD  2333

Query  1726  ----------------VDECERHPCGNGTC-----------------KNTVGSYNCLCYP  1752
                             +    R+P     C                 + TV ++  LC  
Sbjct  2334  NREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTV-AFKKLCPH  2392

Query  1753  GFELTHNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECV  1812
             G     N    DIDEC      VCRNG C N+ GS+ C+C  GY   + G +C+D NEC 
Sbjct  2393  GRGFMTNG--ADIDECKVIH-DVCRNGECVNDRGSYHCICKTGYTPDITGTSCVDLNECN  2449

Query  1813  ALPGSCSPGTCQNLEGSFRCICPPGYEVKSE--SCIDINECNEDPNICLFGSCTNTPGGF  1870
               P  C+   C+N EGS++C CP GY ++ +  SC D++EC    + C F  C NT GGF
Sbjct  2450  QAPKPCN-FICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQF-LCVNTIGGF  2507

Query  1871  QCICPTGFVLSDNGRRCFDTRQSFCFTNFENGK-----------CSVPKAFNTTKAKCCC  1919
              C CP GF  + +   C D  +     N    K           C   + F+  +    C
Sbjct  2508  TCKCPPGF--TQHHTSCIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQTGSSC  2565

Query  1920  SKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNGHCI  1979
               +        C+   +     ++  CP G+      +    D NECL S  +C    C 
Sbjct  2566  EDVDECEGNHRCQHGCQNIIGGYRCSCPQGYLQHYQWNQCV-DENECL-SAHICGGASCH  2623

Query  1980  NTDGSFRCECPMGYNLDYTGVHCIDTDEC-SIGNPCGNGTCTNVIGSFECNCHEGF  2034
             NT GS++C CP G+  +     C D +EC S   PC  G C+N  G + C C  G+
Sbjct  2624  NTLGSYKCMCPAGFQYEQFSGGCQDINECGSAQAPCSYG-CSNTEGGYLCGCPPGY  2678


 Score = 627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/1217 (37%), Positives = 588/1217 (48%), Gaps = 136/1217 (11%)

Query  1     DYRTGPCFTQVNNQMCQGQLT-----GIVCTKTLCCATIGRAWGHPCEMCPAQPQ-----  50
             D R+G C+  +  +   G        G+  +K  CC ++G+AWG PCEMCPA        
Sbjct  1528  DTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKI  1587

Query  51    --PCRRGFIPNIRTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCD  108
               P   GF PN  T   +D+DECQ +PG+CQGG CINT GS++C+CP G+  NE T+ CD
Sbjct  1588  LCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCD  1647

Query  109   DIDECSIIPGICEGSECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIV--NGRC  166
             D++EC   PGIC    C NTVG+Y CICP  Y+    G+ C+D R S C+ N    N  C
Sbjct  1648  DVNECE-TPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTC  1706

Query  167   AQELPGRFTKRQCCCESGRCWAMGSVPEMCPVRGSDEYRRLCVDGAPAGGGSRGGGTGGN  226
               EL    TK+ CCC      A     E CP+  +DE+  LC    P             
Sbjct  1707  DGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRP-------------  1753

Query  227   GFLPSGNGNGHGHGPRGAGFIPIPGSNGFSPGVGGAGVGTGSSTGNGPIITGLTILNQTI  286
             GF+      G          IP    NG    + G+          G       ++ + I
Sbjct  1754  GFVIDIY-TGLPVDIDECREIPGVCENGVCINMVGS---FRCECPVGFFYNDKLLVCEDI  1809

Query  287   DICKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNGDCTDVDECTSNP--CSNGDCVNTP  344
             D C++ P    N  CI T  SYRC+C  GY+  S G C D +EC   P  CS+G C++T 
Sbjct  1810  DECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTV  1869

Query  345   GSYYCKCHAGFQRTPTKQACIDIDECIQ--------------------------------  372
             GS+YC CH GF+    +  C+DI+EC +                                
Sbjct  1870  GSFYCLCHTGFKTNDDQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDCI  1929

Query  373   --------NGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTT-NMCLNGMC  423
                     NG LC+NG+C+NT GSFQC CN G+E+  DG+ CVD +EC      C  G C
Sbjct  1930  DVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAPGTC  1989

Query  424   INEDGSFKCICKPGFVLAPNGRYCTDIDEC-QTSGICMNGHCINTEGSFRCECPPGLAVG  482
              N DGS++CIC PG+ L      C DIDEC +   IC  G C NTEGSF+C CP G ++ 
Sbjct  1990  QNLDGSYRCICPPGYSL--QNEKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLS  2047

Query  483   VDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAE  542
               GR C D  M S CY   + G C  P     +K ECCCA    G+G+PC  CP +    
Sbjct  2048  SSGRRCQDLRM-SYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEA  2106

Query  543   FHGLCSSGIGITV----DGRDINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRN  598
             F  +C  G GI V       D++EC  +PD+C +G C N  GSYRC C  GY    +G  
Sbjct  2107  FRQICPYGSGIIVGPDDSAVDMDECK-EPDVCKHGQCINTDGSYRCECPFGY--ILAGNE  2163

Query  599   CVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINECESSPCV-NGAC  657
             CVD DECSV    C NG C+N  G + CTC +G+       TCEDINEC  +P +    C
Sbjct  2164  CVDTDECSVGN-PCGNGTCKNVIGGFECTCEEGFEPGPMM-TCEDINECAQNPLLCAFRC  2221

Query  658   RNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGA  717
              N  GS+ C+C  G  L     +C D           +  CE   +  T K   C  L  
Sbjct  2222  VNTYGSYECKCPVGYVLREDRRMCKD-----------EDECEEGKHDCTEKQMECKNLIG  2270

Query  718   AWGSPCERCELDTACSRGFARV-NGVTCEDVNECDVFPGVCPNGRCINSRGSFHCECPEG  776
              +            C  G+ R  +G  C D NEC   PG+C NGRC+N+RGS+ CEC +G
Sbjct  2271  TYM---------CICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDG  2321

Query  777   LTLDGTGRVCLDIRMEQCYLTWDEDECI--RSVPGKFRMDACCCAVGAAWGSDCEECPKP  834
              T       CLD R   C+    ++ C    S         CCC  G  WG  CE CP  
Sbjct  2322  FTASPNQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQ  2381

Query  835   DTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSG  894
              T  ++ LCP G GF   G          DI+ECKV   +C NG+C N  GS+ C C +G
Sbjct  2382  GTVAFKKLCPHGRGFMTNG---------ADIDECKVIHDVCRNGECVNDRGSYHCICKTG  2432

Query  895   FTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGY---ESGFMMMKNCMDID  951
             +T D+   +C D++EC  +P  C +  C NT GS++C C  GY   E G    ++C D+D
Sbjct  2433  YTPDITGTSCVDLNECNQAPKPC-NFICKNTEGSYQCSCPKGYILQEDG----RSCKDLD  2487

Query  952   ECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLC-RNGKCVNM  1010
             EC      C+   CVNT G F C CP G   +     CID NEC+   +LC   G C N 
Sbjct  2488  ECATKQHNCQ-FLCVNTIGGFTCKCPPG--FTQHHTSCIDNNECTSDINLCGSKGICQNT  2544

Query  1011  VGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVR  1070
              G++ C C  G+       SC D+DEC   N  C   C N  G Y CSC  GY       
Sbjct  2545  PGSFTCECQRGFSLDQTGSSCEDVDECE-GNHRCQHGCQNIIGGYRCSCPQGYLQHYQWN  2603

Query  1071  TCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFG  1130
              C D +EC S   IC G  C N  G Y+C+C  GF        C D+NEC      C +G
Sbjct  2604  QCVDENECLS-AHICGGASCHNTLGSYKCMCPAGFQYEQFSGGCQDINECGSAQAPCSYG  2662

Query  1131  ECENTKGSFICHCQLGY  1147
              C NT+G ++C C  GY
Sbjct  2663  -CSNTEGGYLCGCPPGY  2678


 Score = 452 bits (1163),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 411/1278 (32%), Positives = 552/1278 (43%), Gaps = 272/1278 (21%)

Query  947   CMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGK  1006
             C D+DEC+  P LC+GG C+NT GSF+C CP GH+L+   ++C D++ECS    +C  G+
Sbjct  244   CQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKLNEVSQKCEDIDECSTIPGICEGGE  303

Query  1007  CVNMVGTYQCSCNSGYQATPDRRSCTDIDE----CMIMNGGCHTHCTNSEGSYECSCSDG  1062
             C N V +Y C C  G+  +PD   C D+        + NG C      S    +C C  G
Sbjct  304   CTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALTNGRCSNQLPQSITKMQCCCDAG  363

Query  1063  YALMPDV---------RTCADIDECESNPDICDGGQCTNI--------------------  1093
                 P V         R   D ++  S P +  G                          
Sbjct  364   RCWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRPEYPPPPLGPIPPVLPVPPGFPPGP  423

Query  1094  -------PGEYRCLCYDGFMASMDMKTCIDVN---ECDLNSNICMFGECENTKGSFICHC  1143
                    P EY          S +    + VN    C L   +C  G C  T GS  C C
Sbjct  424   QIPVPRPPVEY-------LYPSREPPRVLPVNVTDYCQLVRYLCQNGRCIPTPGSCRCEC  476

Query  1144  QLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIK--CIDLD  1201
               G+ +      C DVDECE    N      C+N  GS+ C CR G+     +  C D+D
Sbjct  477   NKGFQLDLRGE-CIDVDECE---KNPCAGGECINNQGSYTCQCRAGYQSTLTRTECRDID  532

Query  1202  ECSNGTHQCSVNAQCVNSPGSYLCACVEGF--TGDGFTCSDVDECAENVHLCENGQCLNV  1259
             EC      C+ N +C+N+ GS+ C C  GF  T DG  C D+DEC+   ++C NG C+N 
Sbjct  533   ECLQNGRICN-NGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIR-NMCLNGMCINE  590

Query  1260  PGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGG  1319
              G+++C C+ GF  ASD + C+DINEC    IC+ G C N  G + C             
Sbjct  591   DGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRC-------------  637

Query  1320  NCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRV-GNCYLKYGPRG  1378
                          C  GL V   GR                 CVD  +   CY  Y  RG
Sbjct  638   ------------ECFPGLAVGLDGRV----------------CVDTHMRSTCYGGY-KRG  668

Query  1379  DGSLSCNTEIGVGVSRSSCCC-SLGKAWGNPCETCPPVNSTEYNTLCPGGEGFR------  1431
                  C   +   V++S CCC S   A+G PC+ CP  NS EY  LC  G G        
Sbjct  669   ----QCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGSDI  724

Query  1432  ----------PNPITIILE---------------------DIDECQELPGLCQGGNCINT  1460
                       PN I   L                      DI+EC     LC  G C NT
Sbjct  725   NECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQCRNT  784

Query  1461  FGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGG  1520
              GSF C CPKG+    + + CEDIDEC + P  C  G C N+ G++ C C  E       
Sbjct  785   PGSFVCTCPKGFIYKPDLKTCEDIDECESSP--CINGVCKNSPGSFICECSSESTLDPTK  842

Query  1521  HNCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKN  1580
               C++  K  C+++     CE  +     K  CC +  +G AW  PC  C      +   
Sbjct  843   TICIETIKGTCWQTVIDGRCEININGATLKSQCCSS--LGAAWGSPCTLC------QVDP  894

Query  1581  ICGNIPGFTFDIHSGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCE  1640
             ICG   G++  I   +  DIDEC+  PG+C NG+C+N  GSF+C+CP+G + +    +C 
Sbjct  895   ICGK--GYS-RIKGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLDATGRICL  951

Query  1641  DI-----------DECSNGDNLCQRNADCINSPGSY-------------------RCECA  1670
             DI           +EC+       R   C  S G+                     C   
Sbjct  952   DIRLETCFLRYEDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPMRNTPEYEELCPRG  1011

Query  1671  AGF--KLSPNGACV--DRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQ------  1720
              GF  K   NG     D NEC  IP++C+HG C +  GS+KC C +GF    ++      
Sbjct  1012  PGFATKEITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDI  1071

Query  1721  -------------------------------------TMCMDVDECERHP--CGNGTCKN  1741
                                                    CMD+DEC+R P  C  G C N
Sbjct  1072  DECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHN  1131

Query  1742  TVGSYNCLCYPGFELTHN-NDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTL  1800
             T GSY C C PG +L+ N + C+DI+EC      +C NGRC N IG ++C CN GY  T 
Sbjct  1132  TEGSYRCECPPGHQLSPNISACIDINEC-ELSAHLCPNGRCVNLIGKYQCACNPGYHSTP  1190

Query  1801  DGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEV--KSESCIDINECNEDPNIC  1858
             D   C+D +EC  + G C    C N EGS+ C C PG+ +     SC DI+EC ++PNIC
Sbjct  1191  DRLFCVDIDECSIMNGGCET-FCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNIC  1249

Query  1859  LFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQ-----SFCFTNF-ENGK----CSVPK  1908
               G CTN PG ++C+C  GF+ S++ + C D  +     + C +   EN K    C    
Sbjct  1250  DGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDM  1309

Query  1909  AFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTI-----PG-IDDTRE-  1961
              ++  K K  C+ +      + CE+           +C    G+      PG I D  + 
Sbjct  1310  GYSGKKGKTGCTDI------NECEI--GAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKC  1361

Query  1962  -DVNECLESPGVCS-NGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIG-NPCGNGT  2018
              D++EC     +CS +  C NT GS+RC C  GY  D  G  C D DECS   N CGNG 
Sbjct  1362  TDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGD--GFTCTDLDECSENLNLCGNGQ  1419

Query  2019  CTNVIGSFECNCHEGFEP  2036
             C N  G + C C  GF P
Sbjct  1420  CLNAPGGYRCECDMGFVP  1437


 Score = 333 bits (853),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 181/210 (86%), Gaps = 2/210 (1%)

Query  1    DYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNI  60
            DYRTGPCFT ++NQMCQGQL+GIVCTKTLCCAT+GRAWGHPCEMCPAQP PCRRGFIPNI
Sbjct  180  DYRTGPCFTVISNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNI  239

Query  61   RTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGIC  120
            RTGACQDVDECQAIPG+CQGGNCINTVGS+ECKCPAGHK NE +QKC+DIDECS IPGIC
Sbjct  240  RTGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKLNEVSQKCEDIDECSTIPGIC  299

Query  121  EGSECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQELPGRFTKRQCC  180
            EG EC+NTV SYFC CP G+ TS DG+RCID R   C++ + NGRC+ +LP   TK QCC
Sbjct  300  EGGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALTNGRCSNQLPQSITKMQCC  359

Query  181  CESGRCWAMG--SVPEMCPVRGSDEYRRLC  208
            C++GRCW+ G    PEMCP+R ++++ +LC
Sbjct  360  CDAGRCWSPGVTVAPEMCPIRATEDFNKLC  389


 Score = 328 bits (841),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 266/788 (34%), Positives = 367/788 (47%), Gaps = 159/788 (20%)

Query  1305  HCICDDGYELDRTGGNCTDVDECADPI---NCVNGLCVNTPGRYECNCPPDFQLNPTGVG  1361
             HC+C  GY              C  P+    C+NG     P R  C C   F    TG  
Sbjct  133   HCLCQKGY----------IGTHCGQPVCESGCLNGGRCVAPNR--CACTYGF----TGPQ  176

Query  1362  C-VDNRVGNCYLKYGPRG-DGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTE  1419
             C  D R G C+     +   G LS     G+  +++ CC ++G+AWG+PCE CP      
Sbjct  177   CERDYRTGPCFTVISNQMCQGQLS-----GIVCTKTLCCATVGRAWGHPCEMCPAQPH--  229

Query  1420  YNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETR  1479
                  P   GF PN  T   +D+DECQ +PGLCQGGNCINT GSF+C+CP G+ L+E ++
Sbjct  230   -----PCRRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKLNEVSQ  284

Query  1480  ICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTS  1539
              CEDIDEC   PG+C  G C NT+ +Y C CPP +     G  C+D+R  +CY +     
Sbjct  285   KCEDIDECSTIPGICEGGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALTNGR  344

Query  1540  CENELPFNVTKRMCCCTYNVGKAWNKPC----EPCPTPGTAEFKNICG------------  1583
             C N+LP ++TK  CCC  + G+ W+       E CP   T +F  +C             
Sbjct  345   CSNQLPQSITKMQCCC--DAGRCWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRPEYP  402

Query  1584  -------------------------NIPGFTFDIHSGKAVDI------DECKEIPGICAN  1612
                                        P   +   S +   +      D C+ +  +C N
Sbjct  403   PPPLGPIPPVLPVPPGFPPGPQIPVPRPPVEYLYPSREPPRVLPVNVTDYCQLVRYLCQN  462

Query  1613  GVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAG  1672
             G CI   GS RCEC  GF   DL   C D+DEC    N C    +CIN+ GSY C+C AG
Sbjct  463   GRCIPTPGSCRCECNKGFQL-DLRGECIDVDECEK--NPCA-GGECINNQGSYTCQCRAG  518

Query  1673  FKLS-PNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECE-  1730
             ++ +     C D +ECL+   +C++G C++  GS+ C+C+ GF  ++D   C D+DEC  
Sbjct  519   YQSTLTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSI  578

Query  1731  RHPCGNGTCKNTVGSYNCLCYPGFELTHNND-CMDIDECSSFFGQVCRNGRCFNEIGSFK  1789
             R+ C NG C N  GS+ C+C PGF+L  +   C DI+EC +    +C NGRC N  GS++
Sbjct  579   RNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECET--PGICMNGRCVNTDGSYR  636

Query  1790  CLCNEGYELTLDGKNCIDTN------------ECV-------------------ALPGSC  1818
             C C  G  + LDG+ C+DT+            +C+                   A    C
Sbjct  637   CECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPC  696

Query  1819  SPGTCQNLEGSFRCICPPGYEVKSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGF  1878
              P   QN    ++ +C  G  + S    DINEC  DP+IC  G C N  G ++CIC +G+
Sbjct  697   QPCPAQN-SAEYQALCSSGPGMTSAG-SDINECALDPDICPNGICENLRGTYKCICNSGY  754

Query  1879  VLSDNGRRCFDTRQSFCFTNF-ENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKE  1937
              +   G+ C D  +    +   +NG+               C   PG             
Sbjct  755   EVDSTGKNCVDINECVLNSLLCDNGQ---------------CRNTPG-------------  786

Query  1938  EEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDY  1997
                +F   CP G    P +  T ED++EC  SP  C NG C N+ GSF CEC     LD 
Sbjct  787   ---SFVCTCPKGFIYKPDL-KTCEDIDECESSP--CINGVCKNSPGSFICECSSESTLDP  840

Query  1998  TGVHCIDT  2005
             T   CI+T
Sbjct  841   TKTICIET  848


 Score = 136 bits (343),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 126/294 (43%), Gaps = 54/294 (18%)

Query  1792  CNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVK--SESCIDIN  1849
             C  G+   +    C D +EC A+PG C  G C N  GSF C CP G+++   S+ C DI+
Sbjct  231   CRRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKLNEVSQKCEDID  290

Query  1850  ECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKA  1909
             EC+  P IC  G CTNT   + C CP GF  S +G RC D R  +C+T   NG+CS    
Sbjct  291   ECSTIPGICEGGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALTNGRCSNQLP  350

Query  1910  FNTTKAKCCCSKMPGEGWGDPC----ELCPKEEEVAFQDLC-------------------  1946
              + TK +CCC    G  W        E+CP      F  LC                   
Sbjct  351   QSITKMQCCCDA--GRCWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRPEYPPPPLGP  408

Query  1947  ---------------------PYGHGTIPGIDDTR----EDVNECLESPGVCSNGHCINT  1981
                                  P      P  +  R       + C     +C NG CI T
Sbjct  409   IPPVLPVPPGFPPGPQIPVPRPPVEYLYPSREPPRVLPVNVTDYCQLVRYLCQNGRCIPT  468

Query  1982  DGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGNGTCTNVIGSFECNCHEGFE  2035
              GS RCEC  G+ LD  G  CID DEC   NPC  G C N  GS+ C C  G++
Sbjct  469   PGSCRCECNKGFQLDLRG-ECIDVDECE-KNPCAGGECINNQGSYTCQCRAGYQ  520


 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 80/170 (47%), Gaps = 13/170 (8%)

Query  1871  QCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDP  1930
             +C C  GF      R   D R   CFT   N  C    +        CC+ + G  WG P
Sbjct  165   RCACTYGFTGPQCER---DYRTGPCFTVISNQMCQGQLSGIVCTKTLCCATV-GRAWGHP  220

Query  1931  CELCPKEEEVAFQDLCPYGHGTIPGIDDTR-EDVNECLESPGVCSNGHCINTDGSFRCEC  1989
             CE+CP +         P   G IP I     +DV+EC   PG+C  G+CINT GSF C+C
Sbjct  221   CEMCPAQPH-------PCRRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECKC  273

Query  1990  PMGYNLDYTGVHCIDTDECS-IGNPCGNGTCTNVIGSFECNCHEGFEPGP  2038
             P G+ L+     C D DECS I   C  G CTN + S+ C C  GF   P
Sbjct  274   PAGHKLNEVSQKCEDIDECSTIPGICEGGECTNTVSSYFCKCPPGFYTSP  323


 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 82/180 (46%), Gaps = 20/180 (11%)

Query  760  GRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRMDACCCA  819
            GRC+       C C  G T     R   D R   C+       C   + G       CCA
Sbjct  158  GRCVAPN---RCACTYGFTGPQCER---DYRTGPCFTVISNQMCQGQLSGIVCTKTLCCA  211

Query  820  -VGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFY-KDINECKVFPGMCMN  877
             VG AWG  CE            +CP  P    RG I   R    +D++EC+  PG+C  
Sbjct  212  TVGRAWGHPCE------------MCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGLCQG  259

Query  878  GKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGY  937
            G C NT+GSF+CKC +G  L+   + C DIDEC   P +C  G C NT  S+ C+C  G+
Sbjct  260  GNCINTVGSFECKCPAGHKLNEVSQKCEDIDECSTIPGICEGGECTNTVSSYFCKCPPGF  319


 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 114/302 (38%), Gaps = 58/302 (19%)

Query  418  CLNGMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCECPP  477
            C+NG   ++D    C+C+ G++    G+   +      SG    G C+      RC C  
Sbjct  123  CMNGGSCSDD---HCLCQKGYIGTHCGQPVCE------SGCLNGGRCV---APNRCAC--  168

Query  478  GLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPA  537
                G  G  C   +    C+  I    C     G V     CCA     +G PC  CPA
Sbjct  169  --TYGFTGPQCERDYRTGPCFTVISNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPA  226

Query  538  KNSAEFHGLCSSGIGITVDGRDINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGR  597
            +      G   +    T   +D++EC   P +C  G C N  GS+ C C +G++ +   +
Sbjct  227  QPHPCRRGFIPNIR--TGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKLNEVSQ  284

Query  598  NCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINECESSPCVNGAC  657
             C DIDECS    +C+ G C NT  SY C CP G+  S +                    
Sbjct  285  KCEDIDECSTIPGICEGGECTNTVSSYFCKCPPGFYTSPD--------------------  324

Query  658  RNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGA  717
                                G  CID   G C+  + + RC   +  +  K +CC   G 
Sbjct  325  --------------------GTRCIDVRPGYCYTALTNGRCSNQLPQSITKMQCCCDAGR  364

Query  718  AW  719
             W
Sbjct  365  CW  366


 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 76/151 (50%), Gaps = 12/151 (8%)

Query  1     DYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWG-HPCEMCPAQPQP-----CRR  54
             D R   CF +  ++ C   + G       CC ++G AWG   CE CP +  P     C R
Sbjct  952   DIRLETCFLRYEDEECTLPIAGRH-RMDACCCSVGAAWGTEECEECPMRNTPEYEELCPR  1010

Query  55    G---FIPNIRTGA--CQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDD  109
             G       I  G    +D++EC+ IP +C  G C NT+GS++C+C +G   +   + C D
Sbjct  1011  GPGFATKEITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTD  1070

Query  110   IDECSIIPGICEGSECSNTVGSYFCICPRGY  140
             IDEC I P +C   +C NT G + C C  GY
Sbjct  1071  IDECRISPDLCGRGQCVNTPGDFECKCDEGY  1101


 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 62/127 (49%), Gaps = 6/127 (5%)

Query  322  GDCTDVDECTSNP--CSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKN  379
            G C DVDEC + P  C  G+C+NT GS+ CKC AG +     Q C DIDEC     +C+ 
Sbjct  242  GACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKLNEVSQKCEDIDECSTIPGICEG  301

Query  380  GRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINE----DGSFKCICK  435
            G C NT  S+ C C  GF  + DG  C+D           NG C N+        +C C 
Sbjct  302  GECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALTNGRCSNQLPQSITKMQCCCD  361

Query  436  PGFVLAP  442
             G   +P
Sbjct  362  AGRCWSP  368


 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 65/120 (54%), Gaps = 8/120 (7%)

Query  284  QTIDICKHHPDLCLNGRCIPTLSSYRCECNMGYK-QDSNGDCTDVDECTSNP--CSNGDC  340
            Q +D C+  P LC  G CI T+ S+ C+C  G+K  + +  C D+DEC++ P  C  G+C
Sbjct  245  QDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKLNEVSQKCEDIDECSTIPGICEGGEC  304

Query  341  VNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVN----TDGSFQCICNAG  396
             NT  SY+CKC  GF  +P    CID+        L  NGRC N    +    QC C+AG
Sbjct  305  TNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTAL-TNGRCSNQLPQSITKMQCCCDAG  363


> sp|Q8N2S1|LTBP4_HUMAN Latent-transforming growth factor beta-binding 
protein 4 OS=Homo sapiens GN=LTBP4 PE=1 SV=2
Length=1624

 Score = 433 bits (1113),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 357/1160 (31%), Positives = 503/1160 (43%), Gaps = 171/1160 (15%)

Query  687   GTCWLNIQDSRCEVNINGATLKSECCATLGAAWG-SPCERCE-----------LDTACSR  734
             G C+  ++   C   + G   +  CC   G AWG   C+ C             D  C  
Sbjct  287   GYCFRELRGGECASPLPGLRTQEVCCRGAGLAWGVHDCQLCSERLGNSERVSAPDGPCPT  346

Query  735   GFARVNGVTCEDVNECDVFPGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQ-  793
             GF RVNG +CEDV+EC    G C +G C N+RG + C CP+G  LD +   C+   +   
Sbjct  347   GFERVNG-SCEDVDECATG-GRCQHGECANTRGGYTCVCPDGFLLDSSRSSCISQHVISE  404

Query  794   ----CYLTWDEDECIRSVPGKFRMDACCCA-VGAAWGSDCEECPKPDTKEYEALCPRGPG  848
                 C+    +  C   +        CCC+ VG AWG  C+ CP   ++ +  +CP GPG
Sbjct  405   AKGPCFRVLRDGGCSLPILRNITKQICCCSRVGKAWGRGCQLCPPFGSEGFREICPAGPG  464

Query  849   FSNRGDILT--GRPFYKDINECKVFPGMCMNGKCRNTIG---------------------  885
             +      L    RP  ++     +     +    R + G                     
Sbjct  465   YHYSASDLRYNTRPLGQEPPRVSLSQPRTLPATSRPSAGFLPTHRLEPRPEPRPDPRPGP  524

Query  886   SFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMK  945
                      +T      +      C  +P +CG G C++ P  + C C  G+       +
Sbjct  525   ELPLPSIPAWTGPEIPESGPSSGMCQRNPQVCGPGRCISRPSGYTCACDSGFRLSPQGTR  584

Query  946   NCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNG  1005
              C+D+DEC R P  C  G C N+ GSF+C C  G    P   EC+DV+EC      C  G
Sbjct  585   -CIDVDECRRVPPPCAPGRCENSPGSFRCVCGPGFRAGPRAAECLDVDECHRVPPPCDLG  643

Query  1006  KCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGC-HTHCTNSEGSYECSCSDGYA  1064
             +C N  G++ C C +GYQA P   SC D+DEC    G C    C N  GS+ C C  G+ 
Sbjct  644   RCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGACKNLPGSFRCVCPAGF-  702

Query  1065  LMPDVRTCA---DIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECD  1121
                  R  A   D+DEC   P  C  G+C N  G + C C  GF +      C DV+EC 
Sbjct  703   -----RGSACEEDVDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECA  757

Query  1122  LNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGS  1181
              +   C +G CENT+GSF C C +G+      + C DVDECE   H       CVN PGS
Sbjct  758   RSPPPCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECE--NHLACPGQECVNSPGS  815

Query  1182  FKC-SCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGF---TGDGFT  1237
             F+C +C  G   +  +C D+DECS+G   C  +  C N+ GS+ C+C  G+   +G    
Sbjct  816   FQCRTCPSGHHLHRGRCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGP  875

Query  1238  CSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTC  1297
             C+DV+EC E      +G+CLN  G++ C C  G+ P     SC D++ECS +++C  G C
Sbjct  876   CADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEEDLCQSGIC  935

Query  1298  NNLPGMFHCICDDGYELDRTGGNCTDVDECAD--PINCVNGLCVNTPGRYEC--NCPPDF  1353
              N  G F CIC  G+       +C DVDEC +  P  C +  C N+PG Y C  +C P +
Sbjct  936   TNTDGSFECICPPGHRAGPDLASCLDVDECRERGPALCGSQRCENSPGSYRCVRDCDPGY  995

Query  1354  QLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCP  1413
                P G  C D  V  C  +YGP   G+  C    G      +C                
Sbjct  996   HAGPEGT-CDD--VDECQ-EYGPEICGAQRCENTPGSYRCTPAC----------------  1035

Query  1414  PVNSTEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYY  1473
                            G++P P     +D+DEC+          C N  GSFQC C +GY 
Sbjct  1036  -------------DPGYQPTPGGGC-QDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYE  1081

Query  1474  LSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICP--PEYMQVNGGHNCMDMRKSF-  1530
              + + R C D++EC    GVCG   C N  G++ C+CP  PE      G  C+  R S  
Sbjct  1082  GARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCPNSPEEFDPMTG-RCVPPRTSAG  1140

Query  1531  ------------------------------------------CYRSYNGT-SCENELPFN  1547
                                                       CY       +C+N L  N
Sbjct  1141  TFPGSQPQAPASPVLPARPPPPPLPRRPSTPRQGPVGSGRRECYFDTAAPDACDNILARN  1200

Query  1548  VTKRMCCCTYNVGKAWNKPC--EPCPTPGTAEFKNICGNIPGF---TFDIHSGKAVDIDE  1602
             VT + CCCT  VG+ W   C  + CP   TAE++++C +  G+   + D+   +  D+DE
Sbjct  1201  VTWQECCCT--VGEGWGSGCRIQQCPGTETAEYQSLCPHGRGYLAPSGDLSLRR--DVDE  1256

Query  1603  CKEIP-GICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINS  1661
             C+     +C +GVC+N    + C C  G+ Y+   L C D DEC++ +  C+    C+N+
Sbjct  1257  CQLFRDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDNDECADEEPACE-GGRCVNT  1315

Query  1662  PGSYRCECAAGFKLSPNGACVDRNECLEIPN-------------VCSHGLCVDMQGSY-K  1707
              GSY C C     L  +      NE   + +             VCSH   +D Q +Y +
Sbjct  1316  VGSYHCTCEPPLVLDGSQRRCVSNESQSLDDNLGVCWQEVGADLVCSHPR-LDRQATYTE  1374

Query  1708  CICHNGFKASQDQTMCMDVD  1727
             C C  G     D  +C   D
Sbjct  1375  CCCLYGEAWGMDCALCPAQD  1394


 Score = 378 bits (971),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 309/901 (34%), Positives = 396/901 (44%), Gaps = 115/901 (13%)

Query  750   CDVFPGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPG  809
             C   P VC  GRCI+    + C C  G  L   G  C+D+           DEC R  P 
Sbjct  549   CQRNPQVCGPGRCISRPSGYTCACDSGFRLSPQGTRCIDV-----------DECRRVPPP  597

Query  810   KFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFYKDINECK  869
                     CA G      CE  P      +  +C  GPGF              D++EC 
Sbjct  598   --------CAPGR-----CENSPG----SFRCVC--GPGFRAGPRAAE----CLDVDECH  634

Query  870   VFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSF  929
               P  C  G+C NT GSF C C +G+       +C D+DEC  SP LCG G C N PGSF
Sbjct  635   RVPPPCDLGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGACKNLPGSF  694

Query  930   ECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREEC  989
              C C     +GF       D+DEC + P  C  G C NT GSF C CP G         C
Sbjct  695   RCVC----PAGFRGSACEEDVDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPC  750

Query  990   IDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCT  1049
              DV+EC+ S   C  G+C N  G++QC C  G+Q       C D+DEC          C 
Sbjct  751   QDVDECARSPPPCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECENHLACPGQECV  810

Query  1050  NSEGSYEC-SCSDGYALMPDVRTCADIDECESNPDIC-DGGQCTNIPGEYRCLCYDGFMA  1107
             NS GS++C +C  G+ L      C D+DEC S    C   G CTN  G +RC C  G+ A
Sbjct  811   NSPGSFQCRTCPSGHHLH--RGRCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRA  868

Query  1108  -SMDMKTCIDVNECDLNSNICM-FGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIG  1165
              S     C DVNEC L  + C   GEC NT GSF C C  GY        C DVDEC   
Sbjct  869   PSGRPGPCADVNEC-LEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECS--  925

Query  1166  AHNCDMHASCVNVPGSFKCSCREGWVG--NGIKCIDLDECSNGTHQCSVNAQCVNSPGSY  1223
               +      C N  GSF+C C  G     +   C+D+DEC         + +C NSPGSY
Sbjct  926   EEDLCQSGICTNTDGSFECICPPGHRAGPDLASCLDVDECRERGPALCGSQRCENSPGSY  985

Query  1224  LCA--CVEGF-TGDGFTCSDVDECAE-NVHLCENGQCLNVPGAYRC--ECEMGFTPASDS  1277
              C   C  G+  G   TC DVDEC E    +C   +C N PG+YRC   C+ G+ P +  
Sbjct  986   RCVRDCDPGYHAGPEGTCDDVDECQEYGPEICGAQRCENTPGSYRCTPACDPGYQP-TPG  1044

Query  1278  KSCQDINECSFQNIC-VFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDECADPIN-CVN  1335
               CQD++EC  ++ C     C NLPG F C+CD GYE  R G +C DV+EC      C  
Sbjct  1045  GGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETLQGVCGA  1104

Query  1336  GLCVNTPGRYECNCP--PDFQLNPTGVGCVDNRVGNCYLK--------------------  1373
              LC N  G + C CP  P+ + +P    CV  R                           
Sbjct  1105  ALCENVEGSFLCVCPNSPE-EFDPMTGRCVPPRTSAGTFPGSQPQAPASPVLPARPPPPP  1163

Query  1374  ---------YGPRGDGSL----------SCNTEIGVGVSRSSCCCSLGKAWGNPC--ETC  1412
                       GP G G            +C+  +   V+   CCC++G+ WG+ C  + C
Sbjct  1164  LPRRPSTPRQGPVGSGRRECYFDTAAPDACDNILARNVTWQECCCTVGEGWGSGCRIQQC  1223

Query  1413  PPVNSTEYNTLCPGGEGF-RPNPITIILEDIDECQELP-GLCQGGNCINTFGSFQCECPK  1470
             P   + EY +LCP G G+  P+    +  D+DECQ     +C+ G C+NT   + C C  
Sbjct  1224  PGTETAEYQSLCPHGRGYLAPSGDLSLRRDVDECQLFRDQVCKSGVCVNTAPGYSCYCSN  1283

Query  1471  GYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNC-------  1523
             GYY   +   C D DEC      C  G C NT+G+Y C C P  +       C       
Sbjct  1284  GYYYHTQRLECIDNDECADEEPACEGGRCVNTVGSYHCTCEPPLVLDGSQRRCVSNESQS  1343

Query  1524  MDMRKSFCYRSYNGTSC--ENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNI  1581
             +D     C++            L    T   CCC Y  G+AW   C  CP   + +F+ +
Sbjct  1344  LDDNLGVCWQEVGADLVCSHPRLDRQATYTECCCLY--GEAWGMDCALCPAQDSDDFEAL  1401

Query  1582  C  1582
             C
Sbjct  1402  C  1402


 Score = 349 bits (896),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 281/853 (33%), Positives = 373/853 (44%), Gaps = 142/853 (17%)

Query  1244  CAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECS-FQNICVFGTCNNLPG  1302
             C  N  +C  G+C++ P  Y C C+ GF  +     C D++EC      C  G C N PG
Sbjct  549   CQRNPQVCGPGRCISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPPPCAPGRCENSPG  608

Query  1303  MFHCICDDGYELDRTGGNCTDVDECAD-PINCVNGLCVNTPGRYECNCPPDFQLNPTGVG  1361
              F C+C  G+        C DVDEC   P  C  G C NTPG + C CP  +Q  P G  
Sbjct  609   SFRCVCGPGFRAGPRAAECLDVDECHRVPPPCDLGRCENTPGSFLCVCPAGYQAAPHGAS  668

Query  1362  CVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYN  1421
             C D  V  C    G  G G+                           C+  P      + 
Sbjct  669   CQD--VDECTQSPGLCGRGA---------------------------CKNLP----GSFR  695

Query  1422  TLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRIC  1481
              +CP G  FR    +   ED+DEC + P  C  G C NT GSF C CP G+        C
Sbjct  696   CVCPAG--FR---GSACEEDVDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPC  750

Query  1482  EDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCE  1541
             +D+DEC   P  C  G C NT G++ C+CP  +     G  C D+ +           CE
Sbjct  751   QDVDECARSPPPCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDE-----------CE  799

Query  1542  NELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDID  1601
             N L        C     V    +  C  CP+                   +H G+  D+D
Sbjct  800   NHL-------ACPGQECVNSPGSFQCRTCPS----------------GHHLHRGRCTDVD  836

Query  1602  ECKE-IPGICANGVCINQIGSFRCECPTGF-SYNDLLLVCEDIDECSNGDNLCQRNADCI  1659
             EC    P    +G C N  GSFRC C  G+ + +     C D++EC  GD  C  + +C+
Sbjct  837   ECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGD-FCFPHGECL  895

Query  1660  NSPGSYRCECAAGFKLSPNGA-CVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQ  1718
             N+ GS+ C CA G++  P GA C+D +EC E  ++C  G+C +  GS++CIC  G +A  
Sbjct  896   NTDGSFACTCAPGYRPGPRGASCLDVDECSEE-DLCQSGICTNTDGSFECICPPGHRAGP  954

Query  1719  DQTMCMDVDEC-ERHP--CGNGTCKNTVGSYNCL--CYPGFELTHNNDCMDIDECSSFFG  1773
             D   C+DVDEC ER P  CG+  C+N+ GSY C+  C PG+       C D+DEC  +  
Sbjct  955   DLASCLDVDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVDECQEYGP  1014

Query  1774  QVCRNGRCFNEIGSFKC--LCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFR  1831
             ++C   RC N  GS++C   C+ GY+ T  G  C D +EC       +   CQNL GSF+
Sbjct  1015  EICGAQRCENTPGSYRCTPACDPGYQPT-PGGGCQDVDECRNRSFCGAHAVCQNLPGSFQ  1073

Query  1832  CICPPGYEVKSE--SCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGR-RCF  1888
             C+C  GYE   +   C+D+NEC     +C    C N  G F C+CP      D    RC 
Sbjct  1074  CLCDQGYEGARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCPNSPEEFDPMTGRCV  1133

Query  1889  DTRQSF--------------------------------------------CFTNFENGKC  1904
               R S                                              F       C
Sbjct  1134  PPRTSAGTFPGSQPQAPASPVLPARPPPPPLPRRPSTPRQGPVGSGRRECYFDTAAPDAC  1193

Query  1905  SVPKAFNTTKAKCCCSKMPGEGWGDPCEL--CPKEEEVAFQDLCPYGHGTIPGIDD--TR  1960
                 A N T  +CCC+   GEGWG  C +  CP  E   +Q LCP+G G +    D   R
Sbjct  1194  DNILARNVTWQECCCTV--GEGWGSGCRIQQCPGTETAEYQSLCPHGRGYLAPSGDLSLR  1251

Query  1961  EDVNEC-LESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNP-CGNGT  2018
              DV+EC L    VC +G C+NT   + C C  GY      + CID DEC+   P C  G 
Sbjct  1252  RDVDECQLFRDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDNDECADEEPACEGGR  1311

Query  2019  CTNVIGSFECNCH  2031
             C N +GS+ C C 
Sbjct  1312  CVNTVGSYHCTCE  1324


 Score = 303 bits (775),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 289/928 (31%), Positives = 384/928 (41%), Gaps = 133/928 (14%)

Query  1078  CESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKG  1137
             C+ NP +C  G+C + P  Y C C  GF  S     CIDV+EC      C  G CEN+ G
Sbjct  549   CQRNPQVCGPGRCISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPPPCAPGRCENSPG  608

Query  1138  SFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVG--NGI  1195
             SF C C  G+        C DVDEC      CD+   C N PGSF C C  G+    +G 
Sbjct  609   SFRCVCGPGFRAGPRAAECLDVDECHRVPPPCDL-GRCENTPGSFLCVCPAGYQAAPHGA  667

Query  1196  KCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECAENVHLCENGQ  1255
              C D+DEC+     C   A C N PGS+ C C  GF G      DVDECA+    C  G+
Sbjct  668   SCQDVDECTQSPGLCGRGA-CKNLPGSFRCVCPAGFRGSACE-EDVDECAQEPPPCGPGR  725

Query  1256  CLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNI-CVFGTCNNLPGMFHCICDDGYEL  1314
             C N  G++ C C  GF        CQD++EC+     C +G C N  G F C+C  G++ 
Sbjct  726   CDNTAGSFHCACPAGFRSRGPGAPCQDVDECARSPPPCTYGRCENTEGSFQCVCPMGFQP  785

Query  1315  DRTGGNCTDVDECADPINCVNGLCVNTPGRYECN-CPPDFQLNPTGVGCVDNRVGNCYLK  1373
             +  G  C DVDEC + + C    CVN+PG ++C  CP    L+     C D  V  C   
Sbjct  786   NTAGSECEDVDECENHLACPGQECVNSPGSFQCRTCPSGHHLH--RGRCTD--VDECSSG  841

Query  1374  YGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPN  1433
               P G      NTE   G  R SC        G                        RP 
Sbjct  842   APPCGPHGHCTNTE---GSFRCSCAPGYRAPSG------------------------RPG  874

Query  1434  PITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGV  1493
             P      D++EC E       G C+NT GSF C C  GY        C D+DEC +   +
Sbjct  875   PCA----DVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDEC-SEEDL  929

Query  1494  CGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMC  1553
             C  G C NT G++ CICPP +       +C+D+ +           C    P     + C
Sbjct  930   CQSGICTNTDGSFECICPPGHRAGPDLASCLDVDE-----------CRERGPALCGSQRC  978

Query  1554  CCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEI-PGICAN  1612
                       N P           ++ +    PG+      G   D+DEC+E  P IC  
Sbjct  979   ---------ENSP---------GSYRCVRDCDPGYHAGPE-GTCDDVDECQEYGPEICGA  1019

Query  1613  GVCINQIGSFRCECPTGFSYNDLLLV-CEDIDECSNGDNLCQRNADCINSPGSYRCECAA  1671
               C N  GS+RC       Y       C+D+DEC N  + C  +A C N PGS++C C  
Sbjct  1020  QRCENTPGSYRCTPACDPGYQPTPGGGCQDVDECRN-RSFCGAHAVCQNLPGSFQCLCDQ  1078

Query  1672  GFKLSPNGA-CVDRNECLEIPNVCSHGLCVDMQGSYKCICHNG-----------------  1713
             G++ + +G  CVD NEC  +  VC   LC +++GS+ C+C N                  
Sbjct  1079  GYEGARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCPNSPEEFDPMTGRCVPPRTS  1138

Query  1714  ---FKASQDQTMC-----MDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCMDI  1765
                F  SQ Q                    +   +  VGS    CY  F+    + C +I
Sbjct  1139  AGTFPGSQPQAPASPVLPARPPPPPLPRRPSTPRQGPVGSGRRECY--FDTAAPDACDNI  1196

Query  1766  -------DEC----SSFFGQVCRNGRCF-NEIGSFKCLCNEGY-ELTLDGKNCI--DTNE  1810
                     EC       +G  CR  +C   E   ++ LC  G   L   G   +  D +E
Sbjct  1197  LARNVTWQECCCTVGEGWGSGCRIQQCPGTETAEYQSLCPHGRGYLAPSGDLSLRRDVDE  1256

Query  1811  CVALPGS-CSPGTCQNLEGSFRCICPPGYEVKSE--SCIDINECNEDPNICLFGSCTNTP  1867
             C       C  G C N    + C C  GY   ++   CID +EC ++   C  G C NT 
Sbjct  1257  CQLFRDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDNDECADEEPACEGGRCVNTV  1316

Query  1868  GGFQCICPTGFVLSDNGRRC-------FDTRQSFCFTNF-ENGKCSVPKA-FNTTKAKCC  1918
             G + C C    VL  + RRC        D     C+     +  CS P+     T  +CC
Sbjct  1317  GSYHCTCEPPLVLDGSQRRCVSNESQSLDDNLGVCWQEVGADLVCSHPRLDRQATYTECC  1376

Query  1919  CSKMPGEGWGDPCELCPKEEEVAFQDLC  1946
             C  + GE WG  C LCP ++   F+ LC
Sbjct  1377  C--LYGEAWGMDCALCPAQDSDDFEALC  1402


 Score = 292 bits (748),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 346/1183 (29%), Positives = 470/1183 (40%), Gaps = 182/1183 (15%)

Query  5     GPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWG-HPCEMCPAQPQPCRRGFIPNIRTG  63
             G CF ++    C   L G+  T+ +CC   G AWG H C++C             + R G
Sbjct  287   GYCFRELRGGECASPLPGLR-TQEVCCRGAGLAWGVHDCQLC-------------SERLG  332

Query  64    ACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICEGS  123
               +                    V + +  CP G ++   +  C+D+DEC+   G C+  
Sbjct  333   NSE-------------------RVSAPDGPCPTGFERVNGS--CEDVDECATG-GRCQHG  370

Query  124   ECSNTVGSYFCICPRGYVTSTDGSRCIDQRAST-----CFSNIVNGRCAQELPGRFTKRQ  178
             EC+NT G Y C+CP G++  +  S CI Q   +     CF  + +G C+  +    TK+ 
Sbjct  371   ECANTRGGYTCVCPDGFLLDSSRSSCISQHVISEAKGPCFRVLRDGGCSLPILRNITKQI  430

Query  179   CCCES-GRCWAMGSVPEMCPVRGSDEYRRLCVDGAPAGGG-----------SRGGGTGGN  226
             CCC   G+ W  G   ++CP  GS+ +R +C    PAG G           +R  G    
Sbjct  431   CCCSRVGKAWGRGC--QLCPPFGSEGFREIC----PAGPGYHYSASDLRYNTRPLGQEPP  484

Query  227   GFLPSGNGNGHGHGPRGAGFIPIPGSNGFSPGVGGAGVGTGSSTGNGPIITGLTILNQ--  284
                 S            AGF+P                G      + P  TG  I     
Sbjct  485   RVSLSQPRTLPATSRPSAGFLPTHRLEPRPEPRPDPRPGPELPLPSIPAWTGPEIPESGP  544

Query  285   TIDICKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNG-DCTDVDEC--TSNPCSNGDCV  341
             +  +C+ +P +C  GRCI   S Y C C+ G++    G  C DVDEC     PC+ G C 
Sbjct  545   SSGMCQRNPQVCGPGRCISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPPPCAPGRCE  604

Query  342   NTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTT  401
             N+PGS+ C C  GF+  P    C+D+DEC +    C  GRC NT GSF C+C AG++   
Sbjct  605   NSPGSFRCVCGPGFRAGPRAAECLDVDECHRVPPPCDLGRCENTPGSFLCVCPAGYQAAP  664

Query  402   DGKNCVDHDECTTT-NMCLNGMCINEDGSFKCICKPGFVLAPNGRYC-TDIDEC-QTSGI  458
              G +C D DECT +  +C  G C N  GSF+C+C  GF     G  C  D+DEC Q    
Sbjct  665   HGASCQDVDECTQSPGLCGRGACKNLPGSFRCVCPAGF----RGSACEEDVDECAQEPPP  720

Query  459   CMNGHCINTEGSFRCECPPGLAVGVDGRVCVD-----------THMRSTCYGGIKKGACV  507
             C  G C NT GSF C CP G      G  C D           T+ R     G  +  C 
Sbjct  721   CGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECARSPPPCTYGRCENTEGSFQCVCP  780

Query  508   RPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHG-----LCSSGIGITVDGR--DI  560
               F      SEC     D    E    CP +      G      C SG  +   GR  D+
Sbjct  781   MGFQPNTAGSEC----EDVDECENHLACPGQECVNSPGSFQCRTCPSGHHLH-RGRCTDV  835

Query  561   NECALDPDIC-SNGICENLRGSYRCNCNSGYEPDPSGR--NCVDIDECSVNRLLCDNGLC  617
             +EC+     C  +G C N  GS+RC+C  GY   PSGR   C D++EC        +G C
Sbjct  836   DECSSGAPPCGPHGHCTNTEGSFRCSCAPGYR-APSGRPGPCADVNECLEGDFCFPHGEC  894

Query  618   RNTPGSYSCTCPKGYVFSTETDTCEDINEC-ESSPCVNGACRNNLGSFNCECSPGSKLDS  676
              NT GS++CTC  GY       +C D++EC E   C +G C N  GSF C C PG +   
Sbjct  895   LNTDGSFACTCAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTDGSFECICPPGHRAGP  954

Query  677   TGLICIDSLKGTCWLNIQDSRCEVNINGATL-KSECCATLGAAWGSPCERCELDTACSRG  735
                 C+D               E    G  L  S+ C     ++     RC  D  C  G
Sbjct  955   DLASCLDVD-------------ECRERGPALCGSQRCENSPGSY-----RCVRD--CDPG  994

Query  736   FARVNGVTCEDVNECDVF-PGVCPNGRCINSRGSFHC--ECPEGLTLDGTGRVCLDIRME  792
             +      TC+DV+EC  + P +C   RC N+ GS+ C   C  G      G  C D+   
Sbjct  995   YHAGPEGTCDDVDECQEYGPEICGAQRCENTPGSYRCTPACDPGYQPT-PGGGCQDVDEC  1053

Query  793   QCYLTWDEDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNR  852
             +           +++PG F+   C C  G     D   C                     
Sbjct  1054  RNRSFCGAHAVCQNLPGSFQ---CLCDQGYEGARDGRHC---------------------  1089

Query  853   GDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKC-NSGFTLDMEERNCTDIDECW  911
                        D+NEC+   G+C    C N  GSF C C NS    D     C       
Sbjct  1090  ----------VDVNECETLQGVCGAALCENVEGSFLCVCPNSPEEFDPMTGRCV------  1133

Query  912   ISPDLCGSGTCVNTPGSF-ECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTC-VNTE  969
               P    +GT    PGS  +        +               + P+      C  +T 
Sbjct  1134  --PPRTSAGT---FPGSQPQAPASPVLPARPPPPPLPRRPSTPRQGPVGSGRRECYFDTA  1188

Query  970   GSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNM-VGTYQCSC--NSGYQA-T  1025
                 CD  L   ++  +E C  V E     S CR  +C       YQ  C    GY A +
Sbjct  1189  APDACDNILARNVT-WQECCCTVGE--GWGSGCRIQQCPGTETAEYQSLCPHGRGYLAPS  1245

Query  1026  PDRRSCTDIDECMIMNGGC--HTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPD  1083
              D     D+DEC +          C N+   Y C CS+GY        C D DEC     
Sbjct  1246  GDLSLRRDVDECQLFRDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDNDECADEEP  1305

Query  1084  ICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNI  1126
              C+GG+C N  G Y C C    +     + C+      L+ N+
Sbjct  1306  ACEGGRCVNTVGSYHCTCEPPLVLDGSQRRCVSNESQSLDDNL  1348


 Score = 291 bits (745),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 214/626 (34%), Positives = 294/626 (47%), Gaps = 66/626 (11%)

Query  1468  CPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMR  1527
             CP G+     +  CED+DEC A  G C  G C NT G YTC+CP  ++  +   +C+   
Sbjct  344   CPTGFERVNGS--CEDVDEC-ATGGRCQHGECANTRGGYTCVCPDGFLLDSSRSSCISQH  400

Query  1528  -----KSFCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNIC  1582
                  K  C+R      C   +  N+TK++CCC+  VGKAW + C+ CP  G+  F+ IC
Sbjct  401   VISEAKGPCFRVLRDGGCSLPILRNITKQICCCS-RVGKAWGRGCQLCPPFGSEGFREIC  459

Query  1583  GNIPGFTFDI-----------HSGKAVDIDECKEIPGIC---ANGVCINQIGSFRCECPT  1628
                PG+ +                  V + + + +P      A  +  +++       P 
Sbjct  460   PAGPGYHYSASDLRYNTRPLGQEPPRVSLSQPRTLPATSRPSAGFLPTHRLEPRPEPRPD  519

Query  1629  GFSYNDLLLVC------EDIDECSNGDNLCQRNAD------CINSPGSYRCECAAGFKLS  1676
                  +L L         +I E      +CQRN        CI+ P  Y C C +GF+LS
Sbjct  520   PRPGPELPLPSIPAWTGPEIPESGPSSGMCQRNPQVCGPGRCISRPSGYTCACDSGFRLS  579

Query  1677  PNGA-CVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECER--HP  1733
             P G  C+D +EC  +P  C+ G C +  GS++C+C  GF+A      C+DVDEC R   P
Sbjct  580   PQGTRCIDVDECRRVPPPCAPGRCENSPGSFRCVCGPGFRAGPRAAECLDVDECHRVPPP  639

Query  1734  CGNGTCKNTVGSYNCLCYPGFELT-HNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLC  1792
             C  G C+NT GS+ C+C  G++   H   C D+DEC+   G +C  G C N  GSF+C+C
Sbjct  640   CDLGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPG-LCGRGACKNLPGSFRCVC  698

Query  1793  NEGYELTLDGKNCI-DTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKS--ESCIDIN  1849
               G+     G  C  D +EC   P  C PG C N  GSF C CP G+  +     C D++
Sbjct  699   PAGFR----GSACEEDVDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVD  754

Query  1850  ECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQ---------SFCFTNFE  1900
             EC   P  C +G C NT G FQC+CP GF  +  G  C D  +           C  +  
Sbjct  755   ECARSPPPCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECENHLACPGQECVNSPG  814

Query  1901  NGKCSV-PKAFNTTKAKC-----CCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIP  1954
             + +C   P   +  + +C     C S  P  G    C       E +F+  C  G+    
Sbjct  815   SFQCRTCPSGHHLHRGRCTDVDECSSGAPPCGPHGHC----TNTEGSFRCSCAPGYRAPS  870

Query  1955  GIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPC  2014
             G      DVNECLE      +G C+NTDGSF C C  GY     G  C+D DECS  + C
Sbjct  871   GRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEEDLC  930

Query  2015  GNGTCTNVIGSFECNCHEGFEPGPMM  2040
              +G CTN  GSFEC C  G   GP +
Sbjct  931   QSGICTNTDGSFECICPPGHRAGPDL  956


 Score = 252 bits (644),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 207/619 (33%), Positives = 283/619 (46%), Gaps = 67/619 (11%)

Query  1445  CQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLG  1504
             CQ  P +C  G CI+    + C C  G+ LS +   C D+DEC   P  C PG C N+ G
Sbjct  549   CQRNPQVCGPGRCISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPPPCAPGRCENSPG  608

Query  1505  NYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWN  1564
             ++ C+C P +        C+D+ +  C+R                   C    ++G+  N
Sbjct  609   SFRCVCGPGFRAGPRAAECLDVDE--CHR---------------VPPPC----DLGRCEN  647

Query  1565  KPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICANGVCINQIGSFRC  1624
                    TPG+  F  +C    G+    H     D+DEC + PG+C  G C N  GSFRC
Sbjct  648   -------TPGS--FLCVCPA--GYQAAPHGASCQDVDECTQSPGLCGRGACKNLPGSFRC  696

Query  1625  ECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFK-LSPNGACVD  1683
              CP GF  +      ED+DEC+     C     C N+ GS+ C C AGF+   P   C D
Sbjct  697   VCPAGFRGSACE---EDVDECAQEPPPCG-PGRCDNTAGSFHCACPAGFRSRGPGAPCQD  752

Query  1684  RNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERH-PCGNGTCKNT  1742
              +EC   P  C++G C + +GS++C+C  GF+ +   + C DVDECE H  C    C N+
Sbjct  753   VDECARSPPPCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECENHLACPGQECVNS  812

Query  1743  VGSYNCLCYPGFELTHNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDG  1802
              GS+ C   P     H   C D+DECSS       +G C N  GSF+C C  GY      
Sbjct  813   PGSFQCRTCPSGHHLHRGRCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGR  872

Query  1803  KN-CIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEV--KSESCIDINECNEDPNICL  1859
                C D NEC+        G C N +GSF C C PGY    +  SC+D++EC+E+ ++C 
Sbjct  873   PGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEE-DLCQ  931

Query  1860  FGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCC  1919
              G CTNT G F+CICP G     +   C D  +           C   +  N+  +  C 
Sbjct  932   SGICTNTDGSFECICPPGHRAGPDLASCLDVDEC---RERGPALCGSQRCENSPGSYRCV  988

Query  1920  SK-MPG-----EGWGDPCELCPKE-EEVAFQDLCPYGHGTI-------PGIDDTR----E  1961
                 PG     EG  D  + C +   E+     C    G+        PG   T     +
Sbjct  989   RDCDPGYHAGPEGTCDDVDECQEYGPEICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQ  1048

Query  1962  DVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDEC-SIGNPCGNGTCT  2020
             DV+EC       ++  C N  GSF+C C  GY     G HC+D +EC ++   CG   C 
Sbjct  1049  DVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETLQGVCGAALCE  1108

Query  2021  NVIGSFEC---NCHEGFEP  2036
             NV GSF C   N  E F+P
Sbjct  1109  NVEGSFLCVCPNSPEEFDP  1127


 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 101/222 (45%), Gaps = 27/222 (12%)

Query  26    TKTLCCATIGRAWGHPC--EMCP----AQPQ---PCRRGFI-PNIRTGACQDVDECQAIP  75
             T   CC T+G  WG  C  + CP    A+ Q   P  RG++ P+      +DVDECQ   
Sbjct  1202  TWQECCCTVGEGWGSGCRIQQCPGTETAEYQSLCPHGRGYLAPSGDLSLRRDVDECQLFR  1261

Query  76    -GVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICEGSECSNTVGSYFC  134
               VC+ G C+NT   Y C C  G+  +    +C D DEC+     CEG  C NTVGSY C
Sbjct  1262  DQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDNDECADEEPACEGGRCVNTVGSYHC  1321

Query  135   ICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQE-----------LPGRFTKRQCCCES  183
              C    V      RC+   + +   N+  G C QE           L  + T  +CCC  
Sbjct  1322  TCEPPLVLDGSQRRCVSNESQSLDDNL--GVCWQEVGADLVCSHPRLDRQATYTECCCLY  1379

Query  184   GRCWAMGSVPEMCPVRGSDEYRRLC-VDGAPAGGGSRGGGTG  224
             G  W M     +CP + SD++  LC V   PA    R GG G
Sbjct  1380  GEAWGMDCA--LCPAQDSDDFEALCNVLRPPAYSPPRPGGFG  1419


 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 3/76 (4%)

Query  335   CSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGV---LCKNGRCVNTDGSFQC  391
             C+NG CV  P  + C+C  G++   T+ AC+DI+EC +      LC N RC+NTDGSF+C
Sbjct  1543  CTNGRCVRVPEGFTCRCFDGYRLDMTRMACVDINECDEAEAASPLCVNARCLNTDGSFRC  1602

Query  392   ICNAGFELTTDGKNCV  407
             IC  GF  T    +C 
Sbjct  1603  ICRPGFAPTHQPHHCA  1618


 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 43/81 (53%), Gaps = 6/81 (7%)

Query  374   GVL--CKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDEC----TTTNMCLNGMCINED  427
             G+L  C NGRCV     F C C  G+ L      CVD +EC      + +C+N  C+N D
Sbjct  1538  GILDGCTNGRCVRVPEGFTCRCFDGYRLDMTRMACVDINECDEAEAASPLCVNARCLNTD  1597

Query  428   GSFKCICKPGFVLAPNGRYCT  448
             GSF+CIC+PGF       +C 
Sbjct  1598  GSFRCICRPGFAPTHQPHHCA  1618


 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 81/191 (42%), Gaps = 20/191 (10%)

Query  374   GVLCKNGRCVNTD-GSFQCICNAG---FELTTDGKNCVDHDECTT--TNMCLNGMCINED  427
             G  C+  +C  T+   +Q +C  G      + D     D DEC      +C +G+C+N  
Sbjct  1215  GSGCRIQQCPGTETAEYQSLCPHGRGYLAPSGDLSLRRDVDECQLFRDQVCKSGVCVNTA  1274

Query  428   GSFKCICKPGFVLAPNGRYCTDIDECQ-TSGICMNGHCINTEGSFRCECPPGLAVGVDGR  486
               + C C  G+        C D DEC      C  G C+NT GS+ C C P L +    R
Sbjct  1275  PGYSCYCSNGYYYHTQRLECIDNDECADEEPACEGGRCVNTVGSYHCTCEPPLVLDGSQR  1334

Query  487   VCVDTHMRS------TCYGGIKKG-ACVRP-FPGAVTKSECCCANPDYG--FGEPCHPCP  536
              CV    +S       C+  +     C  P      T +ECCC    YG  +G  C  CP
Sbjct  1335  RCVSNESQSLDDNLGVCWQEVGADLVCSHPRLDRQATYTECCCL---YGEAWGMDCALCP  1391

Query  537   AKNSAEFHGLC  547
             A++S +F  LC
Sbjct  1392  AQDSDDFEALC  1402


 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (57%), Gaps = 3/69 (4%)

Query  1083  DICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECD---LNSNICMFGECENTKGSF  1139
             D C  G+C  +P  + C C+DG+   M    C+D+NECD     S +C+   C NT GSF
Sbjct  1541  DGCTNGRCVRVPEGFTCRCFDGYRLDMTRMACVDINECDEAEAASPLCVNARCLNTDGSF  1600

Query  1140  ICHCQLGYS  1148
              C C+ G++
Sbjct  1601  RCICRPGFA  1609


 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 41/88 (47%), Gaps = 4/88 (5%)

Query  412   CTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDIDEC----QTSGICMNGHCINT  467
             C   + C NG C+     F C C  G+ L      C DI+EC      S +C+N  C+NT
Sbjct  1537  CGILDGCTNGRCVRVPEGFTCRCFDGYRLDMTRMACVDINECDEAEAASPLCVNARCLNT  1596

Query  468   EGSFRCECPPGLAVGVDGRVCVDTHMRS  495
             +GSFRC C PG A       C     R+
Sbjct  1597  DGSFRCICRPGFAPTHQPHHCAPARPRA  1624


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 11/82 (13%)

Query  915   DLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDEC---ERNPLLCRGGTCVNTEGS  971
             D C +G CV  P  F C CFDGY      M  C+DI+EC   E    LC    C+NT+GS
Sbjct  1541  DGCTNGRCVRVPEGFTCRCFDGYRLDMTRMA-CVDINECDEAEAASPLCVNARCLNTDGS  1599

Query  972   FQCDCPLG-------HELSPSR  986
             F+C C  G       H  +P+R
Sbjct  1600  FRCICRPGFAPTHQPHHCAPAR  1621


 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 41/75 (55%), Gaps = 5/75 (7%)

Query  1690  IPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHP-----CGNGTCKNTVG  1744
             I + C++G CV +   + C C +G++    +  C+D++EC+        C N  C NT G
Sbjct  1539  ILDGCTNGRCVRVPEGFTCRCFDGYRLDMTRMACVDINECDEAEAASPLCVNARCLNTDG  1598

Query  1745  SYNCLCYPGFELTHN  1759
             S+ C+C PGF  TH 
Sbjct  1599  SFRCICRPGFAPTHQ  1613


 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 34/68 (50%), Gaps = 4/68 (6%)

Query  1973  CSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDEC----SIGNPCGNGTCTNVIGSFEC  2028
             C+NG C+     F C C  GY LD T + C+D +EC    +    C N  C N  GSF C
Sbjct  1543  CTNGRCVRVPEGFTCRCFDGYRLDMTRMACVDINECDEAEAASPLCVNARCLNTDGSFRC  1602

Query  2029  NCHEGFEP  2036
              C  GF P
Sbjct  1603  ICRPGFAP  1610


 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 38/73 (52%), Gaps = 6/73 (8%)

Query  1286  CSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDEC-----ADPINCVNGLCVN  1340
             C   + C  G C  +P  F C C DGY LD T   C D++EC     A P+ CVN  C+N
Sbjct  1537  CGILDGCTNGRCVRVPEGFTCRCFDGYRLDMTRMACVDINECDEAEAASPL-CVNARCLN  1595

Query  1341  TPGRYECNCPPDF  1353
             T G + C C P F
Sbjct  1596  TDGSFRCICRPGF  1608


 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 34/66 (52%), Gaps = 3/66 (5%)

Query  1776  CRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNEC---VALPGSCSPGTCQNLEGSFRC  1832
             C NGRC      F C C +GY L +    C+D NEC    A    C    C N +GSFRC
Sbjct  1543  CTNGRCVRVPEGFTCRCFDGYRLDMTRMACVDINECDEAEAASPLCVNARCLNTDGSFRC  1602

Query  1833  ICPPGY  1838
             IC PG+
Sbjct  1603  ICRPGF  1608


 Score = 50.8 bits (120),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 35/66 (53%), Gaps = 3/66 (5%)

Query  875   CMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDEC---WISPDLCGSGTCVNTPGSFEC  931
             C NG+C      F C+C  G+ LDM    C DI+EC     +  LC +  C+NT GSF C
Sbjct  1543  CTNGRCVRVPEGFTCRCFDGYRLDMTRMACVDINECDEAEAASPLCVNARCLNTDGSFRC  1602

Query  932   ECFDGY  937
              C  G+
Sbjct  1603  ICRPGF  1608


 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 56/116 (48%), Gaps = 12/116 (10%)

Query  1894  FCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWG-DPCELCPKE----EEVAFQD-LCP  1947
             +CF     G+C+ P     T+  CC  +  G  WG   C+LC +     E V+  D  CP
Sbjct  288   YCFRELRGGECASPLPGLRTQEVCC--RGAGLAWGVHDCQLCSERLGNSERVSAPDGPCP  345

Query  1948  YGHGTIPGIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCI  2003
              G   + G   + EDV+EC    G C +G C NT G + C CP G+ LD +   CI
Sbjct  346   TGFERVNG---SCEDVDECATG-GRCQHGECANTRGGYTCVCPDGFLLDSSRSSCI  397


 Score = 49.7 bits (117),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 3/76 (4%)

Query  960   CRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDS---LCRNGKCVNMVGTYQC  1016
             C  G CV     F C C  G+ L  +R  C+D+NEC  +++   LC N +C+N  G+++C
Sbjct  1543  CTNGRCVRVPEGFTCRCFDGYRLDMTRMACVDINECDEAEAASPLCVNARCLNTDGSFRC  1602

Query  1017  SCNSGYQATPDRRSCT  1032
              C  G+  T     C 
Sbjct  1603  ICRPGFAPTHQPHHCA  1618


> sp|Q14766|LTBP1_HUMAN Latent-transforming growth factor beta-binding 
protein 1 OS=Homo sapiens GN=LTBP1 PE=1 SV=4
Length=1721

 Score = 432 bits (1110),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 351/1168 (30%), Positives = 523/1168 (45%), Gaps = 195/1168 (17%)

Query  680   ICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWG-SPCERCELDTA-------  731
             +   +  G C+     S+C   + G + + +CC T+G +WG + C++C    +       
Sbjct  550   VAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPSYHGYNQM  609

Query  732   --CSRGFARVNGVTCEDVNECDVFPGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLD-  788
               C  G+ RVN   C+D+NEC +  GVCPNG C+N+ GS+ C C  G   D T   C+  
Sbjct  610   MECLPGYKRVNNTFCQDINECQL-QGVCPNGECLNTMGSYRCTCKIGFGPDPTFSSCVPD  668

Query  789   ---IRMEQ--CY-LTWDEDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEAL  842
                I  E+  CY L     +C+  +        CCC+VG AWG  CE+CP P T  ++ +
Sbjct  669   PPVISEEKGPCYRLVSSGRQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAAFKEI  728

Query  843   CPRGPGFSNRGDILTGRPFYKDINECKVF---------------PGMCMNGKCRNTIGSF  887
             CP G G++  G +   RP +  + +  VF               P +    +    + +F
Sbjct  729   CPGGMGYTVSG-VHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEAL-TF  786

Query  888   KCKCNSGF---------------TLDMEERNCTD--------IDECWISPD--LCGSGTC  922
               +   G                +LD E+             I    + P   +    T 
Sbjct  787   SREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPVVIEKTS  846

Query  923   VNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHEL  982
                P     E      S  +      +I+EC  NP +C  G C+N    + C C  G+  
Sbjct  847   PPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCICYEGYRF  906

Query  983   SPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNG  1042
             S  + +C+D++EC+    LC  G+C N  G++ C C +G+ A+ +  +C D+DEC+  + 
Sbjct  907   SEQQRKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDV  966

Query  1043  GCHTHCTNSEGSYECS-CSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCL-  1100
                 HC N+ G++ C  C  GY +    R C DIDEC  NP  C   QC N PG Y+C+ 
Sbjct  967   CGEGHCVNTVGAFRCEYCDSGYRMTQRGR-CEDIDEC-LNPSTCPDEQCVNSPGSYQCVP  1024

Query  1101  CYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVD  1160
             C +GF        C+DV+EC L  N+C  G+C N +GS++C C  GY+       C D+D
Sbjct  1025  CTEGFRGWNGQ--CLDVDEC-LEPNVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDID  1081

Query  1161  ECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIK--CIDLDECSNGTHQCSVNAQCVN  1218
             EC+ G  N  ++  C N  GSF+C+C +G+  +  K  C D+DEC +  H C+ + QC N
Sbjct  1082  ECQQG--NLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDECQH-RHLCA-HGQCRN  1137

Query  1219  SPGSYLCACVEGFTGDGF--TCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASD  1276
             + GS+ C C +G+   G    C D++EC E+  +C+ G C+N  G+Y C C  GF    D
Sbjct  1138  TEGSFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSYDCTCPDGFQ-LDD  1196

Query  1277  SKSCQDINECSFQNIC-VFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDECADPINC-V  1334
             +K+CQDINEC    +C   G C N  G FHC+C  G+ +   G  C D+DEC +   C  
Sbjct  1197  NKTCQDINECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEDIDECVNNTVCDS  1256

Query  1335  NGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKYGPRG-------DGSLSC---  1384
             +G C NT G + C C   FQ    G GCVD  V  C L  G  G       +GS  C   
Sbjct  1257  HGFCDNTAGSFRCLCYQGFQAPQDGQGCVD--VNECELLSGVCGEAFCENVEGSFLCVCA  1314

Query  1385  -----------------NTEIGV----------------------------GVSRSSCCC  1399
                              +T++ V                             V++  CCC
Sbjct  1315  DENQEYSPMTGQCRSRTSTDLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCC  1374

Query  1400  SLGKAWGNPCET--CPPVNSTEYNTLCPGGEGFRPNPITII------LEDIDECQEL-PG  1450
             + G  WG+ CE   CP + + E+  +CP G+GF P   +         +D DEC      
Sbjct  1375  TSGVGWGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADECLLFGQE  1434

Query  1451  LCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCIC  1510
             +C+ G C+NT   ++C C +G Y       C D+DEC   P  C  G C NT G+Y C C
Sbjct  1435  ICKNGFCLNTRPGYECYCKQGTYYDPVKLQCFDMDEC-QDPSSCIDGQCVNTEGSYNCFC  1493

Query  1511  PPEYMQVNGGHNCM------------DMRKSFCYRSYNGT-SCENELP-FNVTKRMCCCT  1556
                 +       C+            D+ +  C+   +    C   L     T   CCC 
Sbjct  1494  THPMVLDASEKRCIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCL  1553

Query  1557  YNVGKAWNKPCEPCPTPGTAEFKNICGNI--------------------------PGFTF  1590
             Y  G+AW   C  CP   + ++  +C NI                          P F  
Sbjct  1554  Y--GEAWGMQCALCPLKDSDDYAQLC-NIPVTGRRQPYGRDALVDFSEQYTPEADPYFIQ  1610

Query  1591  D--IHSGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNG  1648
             D  ++S + +  +EC  + G C NG C+     + C+C  G+  +   + C D++EC   
Sbjct  1611  DRFLNSFEELQAEECGILNG-CENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDEL  1669

Query  1649  DN---LCQRNADCINSPGSYRCECAAGF  1673
             +N   LC +NA CIN+ GSY+C C  G+
Sbjct  1670  NNRMSLC-KNAKCINTDGSYKCLCLPGY  1696


 Score = 361 bits (927),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 378/1260 (30%), Positives = 520/1260 (41%), Gaps = 249/1260 (20%)

Query  3     RTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWG-HPCEMCPAQPQPCRRGFIPNIR  61
             + G CF +     C   L G+   +  CC T+G +WG + C+ CP +P     G+     
Sbjct  555   QLGRCFQETIGSQCGKALPGL-SKQEDCCGTVGTSWGFNKCQKCPKKPS--YHGY-----  606

Query  62    TGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICE  121
                   + EC  +PG  +  N                        C DI+EC +  G+C 
Sbjct  607   ----NQMMEC--LPGYKRVNNTF----------------------CQDINECQLQ-GVCP  637

Query  122   GSECSNTVGSYFCICPRGYVTSTDGSRC------IDQRASTCFSNIVNGR-CAQELPGRF  174
               EC NT+GSY C C  G+      S C      I +    C+  + +GR C   L    
Sbjct  638   NGECLNTMGSYRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSSGRQCMHPLSVHL  697

Query  175   TKRQCCCESGRCWAMGSVPEMCPVRGSDEYRRLCVDGAPAGGGSRGGGTGGNGFLPSGNG  234
             TK+ CCC  G+ W  G   E CP+ G+  ++ +C               GG G+  SG  
Sbjct  698   TKQLCCCSVGKAW--GPHCEKCPLPGTAAFKEIC--------------PGGMGYTVSGVH  741

Query  235   NG---HGHGPRGAGFI---------------PIPG----------SNGFSPGVGGAGVGT  266
                  H H  +G  F+               P+P           S    PGV    V T
Sbjct  742   RRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEVAT  801

Query  267   GSSTGNGPII--------TGLTILNQTIDICKHHPDLCL----NGRCIPTLSSYRCECNM  314
                    P +         G   L+  I     HP   +        +P   +     + 
Sbjct  802   APPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPVVIEKTSPPVPVEVAPEASTSS  861

Query  315   GYKQDSNGDCTDVDECTSNP--CSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQ  372
               +  +    T+++ECT NP  C  G C+N P  Y C C+ G++ +  ++ C+DIDEC Q
Sbjct  862   ASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCICYEGYRFSEQQRKCVDIDECTQ  921

Query  373   NGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKC  432
                LC  GRC NT+GSF CIC AGF  + +G NC+D DEC   ++C  G C+N  G+F+C
Sbjct  922   VQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRC  981

Query  433   -ICKPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRC-ECPPGLAVGVDGRVCVD  490
               C  G+ +   GR C DIDEC     C +  C+N+ GS++C  C  G   G +G+ C+D
Sbjct  982   EYCDSGYRMTQRGR-CEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFR-GWNGQ-CLD  1038

Query  491   THMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGLCSSG  550
                            C+ P           CAN D    E  + C           C  G
Sbjct  1039  V------------DECLEPN---------VCANGDCSNLEGSYMCS----------CHKG  1067

Query  551   IGITVDG---RDINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDIDECSV  607
                T D    RDI+EC    ++C NG C+N  GS+RC C  GY+   +   C DIDEC  
Sbjct  1068  YTRTPDHKHCRDIDECQQG-NLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDECQ-  1125

Query  608   NRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINEC--ESSPCVNGACRNNLGSFN  665
             +R LC +G CRNT GS+ C C +GY  S   D CEDINEC  + S C  G C N  GS++
Sbjct  1126  HRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSYD  1185

Query  666   CECSPGSKLDSTGLICID----------SLKGTCWLNIQDSRCEVNINGATLKSECCATL  715
             C C  G +LD     C D            +G C LN + S   V   G ++        
Sbjct  1186  CTCPDGFQLDDNK-TCQDINECEHPGLCGPQGEC-LNTEGSFHCVCQQGFSI--------  1235

Query  716   GAAWGSPCE---RCELDTAC-SRGF-----------------ARVNGVTCEDVNECDVFP  754
              +A G  CE    C  +T C S GF                 A  +G  C DVNEC++  
Sbjct  1236  -SADGRTCEDIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNECELLS  1294

Query  755   GVCPNGRCINSRGSFHCECP----EGLTLDGTGR----VCLDIRMEQ-------CYLTW-  798
             GVC    C N  GSF C C     E   + G  R      LD+ ++Q       CY    
Sbjct  1295  GVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRTSTDLDVDVDQPKEEKKECYYNLN  1354

Query  799   DEDECIRSVPGKFRMDACCCAVGAAWGSDCE--ECPKPDTKEYEALCPRGPGFSNRGDIL  856
             D   C   +        CCC  G  WG +CE   CP   T E+  +CP+G GF   G+  
Sbjct  1355  DASLCDNVLAPNVTKQECCCTSGVGWGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESS  1414

Query  857   T--GRPFYKDINECKVF-PGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWIS  913
             +  G   YKD +EC +F   +C NG C NT   ++C C  G   D  +  C D+DEC   
Sbjct  1415  SEAGGENYKDADECLLFGQEICKNGFCLNTRPGYECYCKQGTYYDPVKLQCFDMDECQ-D  1473

Query  914   PDLCGSGTCVNTPGSFECEC-----FDGYESG-FMMMKNCMDIDECERNPLLCRGGTCVN  967
             P  C  G CVNT GS+ C C      D  E       ++   I+E +    LC      +
Sbjct  1474  PSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAESNEQIEETDVYQDLCWE----H  1529

Query  968   TEGSFQCDCPLGHELSPSREECIDVNE--------CSLSDSLCRNGKC-VNMVGTYQ---  1015
                 + C  PL  + +   E C    E        C L DS      C + + G  Q   
Sbjct  1530  LSDEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPLKDSDDYAQLCNIPVTGRRQPYG  1589

Query  1016  --CSCNSGYQATPDRRSC------------TDIDECMIMNGGCHTHCTNSEGSYECSCSD  1061
                  +   Q TP+                   +EC I+NG  +  C   +  Y C C D
Sbjct  1590  RDALVDFSEQYTPEADPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFD  1649

Query  1062  GYALMPDVRTCADIDECE---SNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVN  1118
             GY L     TC D++EC+   +   +C   +C N  G Y+CLC  G++ S     C  +N
Sbjct  1650  GYHLDTAKMTCVDVNECDELNNRMSLCKNAKCINTDGSYKCLCLPGYVPSDKPNYCTPLN  1709


 Score = 343 bits (881),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 291/864 (34%), Positives = 392/864 (45%), Gaps = 96/864 (11%)

Query  1052  EGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDM  1111
             E + E S S    ++   +   +I+EC  NPDIC  G C N+P  Y C+CY+G+  S   
Sbjct  852   EVAPEASTSSASQVIAPTQV-TEINECTVNPDICGAGHCINLPVRYTCICYEGYRFSEQQ  910

Query  1112  KTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDM  1171
             + C+D++EC    ++C  G CENT+GSF+C C  G+   +  T C DVDEC +    C  
Sbjct  911   RKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDEC-LRPDVCG-  968

Query  1172  HASCVNVPGSFKCS-CREGW-VGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCA-CV  1228
                CVN  G+F+C  C  G+ +    +C D+DEC N +     + QCVNSPGSY C  C 
Sbjct  969   EGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPS--TCPDEQCVNSPGSYQCVPCT  1026

Query  1229  EGFTGDGFTCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSF  1288
             EGF G    C DVDEC E  ++C NG C N+ G+Y C C  G+T   D K C+DI+EC  
Sbjct  1027  EGFRGWNGQCLDVDECLEP-NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQ  1085

Query  1289  QNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECN  1348
              N+CV G C N  G F C C  GY+L      C D+DEC     C +G C NT G ++C 
Sbjct  1086  GNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEGSFQCV  1145

Query  1349  CPPDFQLNPTGVGCVDNRVGNCYLKYG--PRGD-----GSLSCNTEIGVGVSRSSCCCSL  1401
             C   ++ +  G  C D  +  C        RGD     GS  C    G  +  +  C  +
Sbjct  1146  CDQGYRASGLGDHCED--INECLEDKSVCQRGDCINTAGSYDCTCPDGFQLDDNKTCQDI  1203

Query  1402  GKAWGNPCE---TCPPVN---STEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGG  1455
                  N CE    C P     +TE +  C   +GF  +      EDIDEC         G
Sbjct  1204  -----NECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEDIDECVNNTVCDSHG  1258

Query  1456  NCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICP---P  1512
              C NT GSF+C C +G+   ++ + C D++EC    GVCG   C N  G++ C+C     
Sbjct  1259  FCDNTAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQ  1318

Query  1513  EYMQVNG---GHNCMDM---------RKSFCYRSYNGTS-CENELPFNVTKRMCCCTYNV  1559
             EY  + G        D+          K  CY + N  S C+N L  NVTK+ CCCT  V
Sbjct  1319  EYSPMTGQCRSRTSTDLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGV  1378

Query  1560  GKAWNKPCE--PCPTPGTAEFKNICGNIPGFTFDIHSGKAV------DIDECKEI-PGIC  1610
             G  W   CE  PCP  GTAEF  +C    GF     S          D DEC      IC
Sbjct  1379  G--WGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADECLLFGQEIC  1436

Query  1611  ANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECA  1670
              NG C+N    + C C  G  Y+ + L C D+DEC +  +    +  C+N+ GSY C C 
Sbjct  1437  KNGFCLNTRPGYECYCKQGTYYDPVKLQCFDMDECQDPSSCI--DGQCVNTEGSYNCFCT  1494

Query  1671  AGFKL-SPNGACV---DRNECLEIPN--------------VCSHGLCVDMQGSYKCICHN  1712
                 L +    C+   + NE +E  +              VCS  L        +C C  
Sbjct  1495  HPMVLDASEKRCIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLY  1554

Query  1713  G-----------FKASQDQTMCMDVDEC-ERHPCGNGTCKNTVGSYNCLCYPGF---ELT  1757
             G            K S D     ++     R P G     +    Y     P F      
Sbjct  1555  GEAWGMQCALCPLKDSDDYAQLCNIPVTGRRQPYGRDALVDFSEQYTPEADPYFIQDRFL  1614

Query  1758  HNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGS  1817
             ++ + +  +EC    G  C NGRC      + C C +GY L      C+D NEC  L   
Sbjct  1615  NSFEELQAEECGILNG--CENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDELNNR  1672

Query  1818  ---CSPGTCQNLEGSFRCICPPGY  1838
                C    C N +GS++C+C PGY
Sbjct  1673  MSLCKNAKCINTDGSYKCLCLPGY  1696


 Score = 304 bits (778),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 230/666 (35%), Positives = 319/666 (48%), Gaps = 71/666 (11%)

Query  1414  PVNSTEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYY  1473
             PV      +     +   P  +T    +I+EC   P +C  G+CIN    + C C +GY 
Sbjct  850   PVEVAPEASTSSASQVIAPTQVT----EINECTVNPDICGAGHCINLPVRYTCICYEGYR  905

Query  1474  LSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRK-----  1528
              SE+ R C DIDEC     +C  G C NT G++ CICP  +M    G NC+D+ +     
Sbjct  906   FSEQQRKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPD  965

Query  1529  ----SFCYRSYNGTSCEN-ELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICG  1583
                   C  +     CE  +  + +T+R  C          +  + C  P T   +  C 
Sbjct  966   VCGEGHCVNTVGAFRCEYCDSGYRMTQRGRC----------EDIDECLNPSTCPDEQ-CV  1014

Query  1584  NIPGFT--------FDIHSGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDL  1635
             N PG          F   +G+ +D+DEC E P +CANG C N  GS+ C C  G++    
Sbjct  1015  NSPGSYQCVPCTEGFRGWNGQCLDVDECLE-PNVCANGDCSNLEGSYMCSCHKGYTRTPD  1073

Query  1636  LLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSP-NGACVDRNECLEIPNVC  1694
                C DIDEC  G NLC  N  C N+ GS+RC C  G++LS     C D +EC +  ++C
Sbjct  1074  HKHCRDIDECQQG-NLC-VNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDEC-QHRHLC  1130

Query  1695  SHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDEC--ERHPCGNGTCKNTVGSYNCLCYP  1752
             +HG C + +GS++C+C  G++AS     C D++EC  ++  C  G C NT GSY+C C  
Sbjct  1131  AHGQCRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSYDCTCPD  1190

Query  1753  GFELTHNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECV  1812
             GF+L  N  C DI+EC    G     G C N  GSF C+C +G+ ++ DG+ C D +ECV
Sbjct  1191  GFQLDDNKTCQDINECE-HPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEDIDECV  1249

Query  1813  ALPGSCSPGTCQNLEGSFRCICPPGYEVKS--ESCIDINECNEDPNICLFGSCTNTPGGF  1870
                   S G C N  GSFRC+C  G++     + C+D+NEC     +C    C N  G F
Sbjct  1250  NNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSF  1309

Query  1871  QCICP---------TGFVLSDNGRRC-FDTRQ-----SFCFTNFENGK-CSVPKAFNTTK  1914
              C+C          TG   S        D  Q       C+ N  +   C    A N TK
Sbjct  1310  LCVCADENQEYSPMTGQCRSRTSTDLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTK  1369

Query  1915  AKCCCSKMPGEGWGDPCEL--CPKEEEVAFQDLCPYGHGTIPGIDDTRE-------DVNE  1965
              +CCC+   G GWGD CE+  CP      F ++CP G G +P  + + E       D +E
Sbjct  1370  QECCCTS--GVGWGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADE  1427

Query  1966  CLE-SPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGNGTCTNVIG  2024
             CL     +C NG C+NT   + C C  G   D   + C D DEC   + C +G C N  G
Sbjct  1428  CLLFGQEICKNGFCLNTRPGYECYCKQGTYYDPVKLQCFDMDECQDPSSCIDGQCVNTEG  1487

Query  2025  SFECNC  2030
             S+ C C
Sbjct  1488  SYNCFC  1493


 Score = 270 bits (691),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 275/921 (30%), Positives = 388/921 (42%), Gaps = 162/921 (18%)

Query  1196  KCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEG--FTGDGFTCSDVDECAENVHLCEN  1253
             +  +++EC+     C     C+N P  Y C C EG  F+     C D+DEC +  HLC  
Sbjct  870   QVTEINECTVNPDICGA-GHCINLPVRYTCICYEGYRFSEQQRKCVDIDECTQVQHLCSQ  928

Query  1254  GQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHC-ICDDGY  1312
             G+C N  G++ C C  GF  + +  +C D++EC   ++C  G C N  G F C  CD GY
Sbjct  929   GRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSGY  988

Query  1313  ELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYL  1372
              + + G  C D+DEC +P  C +  CVN+        P  +Q  P   G      G C  
Sbjct  989   RMTQRG-RCEDIDECLNPSTCPDEQCVNS--------PGSYQCVPCTEG-FRGWNGQC--  1036

Query  1373  KYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRP  1432
                      L  +  +   V  +  C +L                 E + +C   +G+  
Sbjct  1037  ---------LDVDECLEPNVCANGDCSNL-----------------EGSYMCSCHKGYTR  1070

Query  1433  NPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPG  1492
              P      DIDECQ+   LC  G C NT GSF+C C +GY LS     CEDIDEC  H  
Sbjct  1071  TPDHKHCRDIDECQQ-GNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDEC-QHRH  1128

Query  1493  VCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRM  1552
             +C  G C NT G++ C+C   Y     G +C D+ +    +S             V +R 
Sbjct  1129  LCAHGQCRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDKS-------------VCQRG  1175

Query  1553  CCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICA-  1611
              C    +  A +  C  CP               GF  D  +    DI+EC E PG+C  
Sbjct  1176  DC----INTAGSYDCT-CPD--------------GFQLD-DNKTCQDINEC-EHPGLCGP  1214

Query  1612  NGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAA  1671
              G C+N  GSF C C  GFS +     CEDIDEC N + +C  +  C N+ GS+RC C  
Sbjct  1215  QGECLNTEGSFHCVCQQGFSISADGRTCEDIDECVN-NTVCDSHGFCDNTAGSFRCLCYQ  1273

Query  1672  GFKLSPNG-ACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQT---------  1721
             GF+   +G  CVD NEC  +  VC    C +++GS+ C+C +  +     T         
Sbjct  1274  GFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRTST  1333

Query  1722  -MCMDVD-------ECERHPCGNGTCKNT----VGSYNCLCYPGFELTHNNDCMDIDEC-  1768
              + +DVD       EC  +      C N     V    C C  G     N +        
Sbjct  1334  DLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGVGWGDNCEIFPCPVLG  1393

Query  1769  SSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGS-CSPGTCQNLE  1827
             ++ F ++C  G+ F   G               G+N  D +EC+      C  G C N  
Sbjct  1394  TAEFTEMCPKGKGFVPAGESSS--------EAGGENYKDADECLLFGQEICKNGFCLNTR  1445

Query  1828  GSFRCICPPG--YEVKSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGR  1885
               + C C  G  Y+     C D++EC +DP+ C+ G C NT G + C C    VL  + +
Sbjct  1446  PGYECYCKQGTYYDPVKLQCFDMDEC-QDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEK  1504

Query  1886  RCF------------DTRQSFCFTNFENGK-CSVPKA-FNTTKAKCCCSKMPGEGWGDPC  1931
             RC             D  Q  C+ +  +   CS P     TT  +CCC  + GE WG  C
Sbjct  1505  RCIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCC--LYGEAWGMQC  1562

Query  1932  ELCPKEEEVAFQDLC---------PYGHGTIPG-------------IDDTREDVNECLES  1969
              LCP ++   +  LC         PYG   +               I D   +  E L++
Sbjct  1563  ALCPLKDSDDYAQLCNIPVTGRRQPYGRDALVDFSEQYTPEADPYFIQDRFLNSFEELQA  1622

Query  1970  P--GV---CSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGN----PCGNGTCT  2020
                G+   C NG C+     + C+C  GY+LD   + C+D +EC   N     C N  C 
Sbjct  1623  EECGILNGCENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAKCI  1682

Query  2021  NVIGSFECNCHEGFEPGPMMN  2041
             N  GS++C C  G+ P    N
Sbjct  1683  NTDGSYKCLCLPGYVPSDKPN  1703


 Score = 258 bits (659),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 238/751 (32%), Positives = 329/751 (44%), Gaps = 83/751 (11%)

Query  1321  CTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDN------RVGNCYLKY  1374
             C D++EC     C NG C+NT G Y C C   F  +PT   CV +        G CY   
Sbjct  624   CQDINECQLQGVCPNGECLNTMGSYRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLV  683

Query  1375  GPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNP  1434
                      C   + V +++  CCCS+GKAWG  CE CP   +  +  +CPGG G+  + 
Sbjct  684   ----SSGRQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGYTVSG  739

Query  1435  ITIILEDIDECQELPGLCQGGNCINTFGSFQCE-CPKGYYLSEETRICEDIDECVAHPGV  1493
             +           + P   +  N      S      P      E      +    VA P V
Sbjct  740   VHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEV  799

Query  1494  CG--PGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKR  1551
                 P     +L        P   Q++ G + + +   F              P  + K 
Sbjct  800   ATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQF--------------PVVIEK-  844

Query  1552  MCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICA  1611
                       +   P E  P   T+    +          I   +  +I+EC   P IC 
Sbjct  845   ---------TSPPVPVEVAPEASTSSASQV----------IAPTQVTEINECTVNPDICG  885

Query  1612  NGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAA  1671
              G CIN    + C C  G+ +++    C DIDEC+   +LC +   C N+ GS+ C C A
Sbjct  886   AGHCINLPVRYTCICYEGYRFSEQQRKCVDIDECTQVQHLCSQ-GRCENTEGSFLCICPA  944

Query  1672  GFKLSPNGA-CVDRNECLEIPNVCSHGLCVDMQGSYKC-ICHNGFKASQDQTMCMDVDEC  1729
             GF  S  G  C+D +ECL  P+VC  G CV+  G+++C  C +G++ +Q +  C D+DEC
Sbjct  945   GFMASEEGTNCIDVDECLR-PDVCGEGHCVNTVGAFRCEYCDSGYRMTQ-RGRCEDIDEC  1002

Query  1730  -ERHPCGNGTCKNTVGSYNCL-CYPGFELTHNNDCMDIDECSSFFGQVCRNGRCFNEIGS  1787
                  C +  C N+ GSY C+ C  GF    N  C+D+DEC      VC NG C N  GS
Sbjct  1003  LNPSTCPDEQCVNSPGSYQCVPCTEGFR-GWNGQCLDVDEC--LEPNVCANGDCSNLEGS  1059

Query  1788  FKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKS--ESC  1845
             + C C++GY  T D K+C D +EC      C  G C+N EGSFRC C  GY++ +  + C
Sbjct  1060  YMCSCHKGYTRTPDHKHCRDIDEC-QQGNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQC  1118

Query  1846  IDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSF----------C  1895
              DI+EC    ++C  G C NT G FQC+C  G+  S  G  C D  +            C
Sbjct  1119  EDIDECQHR-HLCAHGQCRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDC  1177

Query  1896  FTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELC-PKEE----EVAFQDLCPYGH  1950
                  +  C+ P  F     K C      E  G    LC P+ E    E +F  +C  G 
Sbjct  1178  INTAGSYDCTCPDGFQLDDNKTCQDINECEHPG----LCGPQGECLNTEGSFHCVCQQGF  1233

Query  1951  GTIPGIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECS-  2009
              +I     T ED++EC+ +    S+G C NT GSFRC C  G+     G  C+D +EC  
Sbjct  1234  -SISADGRTCEDIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNECEL  1292

Query  2010  IGNPCGNGTCTNVIGSFECNC-HEGFEPGPM  2039
             +   CG   C NV GSF C C  E  E  PM
Sbjct  1293  LSGVCGEAFCENVEGSFLCVCADENQEYSPM  1323


 Score = 258 bits (658),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 224/730 (31%), Positives = 328/730 (45%), Gaps = 104/730 (14%)

Query  534   PCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICSNGICENLRGSYRCNCNSGYEPD  593
             P P + + E     +S +       +INEC ++PDIC  G C NL   Y C C  GY   
Sbjct  848   PVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCICYEGYRFS  907

Query  594   PSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINEC-ESSPC  652
                R CVDIDEC+  + LC  G C NT GS+ C CP G++ S E   C D++EC     C
Sbjct  908   EQQRKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVC  967

Query  653   VNGACRNNLGSFNCE-CSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVN---INGATLK  708
               G C N +G+F CE C  G ++   G                  RCE     +N +T  
Sbjct  968   GEGHCVNTVGAFRCEYCDSGYRMTQRG------------------RCEDIDECLNPSTCP  1009

Query  709   SECCATLGAAWGSPCERCELDTACSRGFARVNGVTCEDVNECDVFPGVCPNGRCINSRGS  768
              E C     ++     +C     C+ GF   NG  C DV+EC + P VC NG C N  GS
Sbjct  1010  DEQCVNSPGSY-----QC---VPCTEGFRGWNG-QCLDVDEC-LEPNVCANGDCSNLEGS  1059

Query  769   FHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRMDACCCAVGAAWGSDC  828
             + C C +G T     + C DI   Q        +C ++  G FR   C C  G    +  
Sbjct  1060  YMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQC-KNTEGSFR---CTCGQGYQLSAAK  1115

Query  829   EECPKPDTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFK  888
             ++C                               +DI+EC+    +C +G+CRNT GSF+
Sbjct  1116  DQC-------------------------------EDIDECQ-HRHLCAHGQCRNTEGSFQ  1143

Query  889   CKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCM  948
             C C+ G+       +C DI+EC     +C  G C+NT GS++C C DG++      K C 
Sbjct  1144  CVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSYDCTCPDGFQ--LDDNKTCQ  1201

Query  949   DIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLC-RNGKC  1007
             DI+ECE   L    G C+NTEGSF C C  G  +S     C D++EC +++++C  +G C
Sbjct  1202  DINECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEDIDEC-VNNTVCDSHGFC  1260

Query  1008  VNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGC-HTHCTNSEGSYECSCSD-GYAL  1065
              N  G+++C C  G+QA  D + C D++EC +++G C    C N EGS+ C C+D     
Sbjct  1261  DNTAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEY  1320

Query  1066  MPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCY----DGFMASMDMKTCIDVNECD  1121
              P    C      + + D+       + P E +  CY    D  +    +   +   EC 
Sbjct  1321  SPMTGQCRSRTSTDLDVDV-------DQPKEEKKECYYNLNDASLCDNVLAPNVTKQECC  1373

Query  1122  LNSNICMFGECE--------NTKGSFICHCQLGY------SVKKGTTGCTDVDECEIGAH  1167
               S +     CE          + + +C    G+      S + G     D DEC +   
Sbjct  1374  CTSGVGWGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADECLLFGQ  1433

Query  1168  NCDMHASCVNVPGSFKCSCREGWVGNGIK--CIDLDECSNGTHQCSVNAQCVNSPGSYLC  1225
                 +  C+N    ++C C++G   + +K  C D+DEC + +    ++ QCVN+ GSY C
Sbjct  1434  EICKNGFCLNTRPGYECYCKQGTYYDPVKLQCFDMDECQDPSS--CIDGQCVNTEGSYNC  1491

Query  1226  ACVEGFTGDG  1235
              C      D 
Sbjct  1492  FCTHPMVLDA  1501


 Score = 193 bits (490),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 192/684 (28%), Positives = 300/684 (44%), Gaps = 103/684 (15%)

Query  1391  GVSRSS-CCCSLGKAWG-NPCETCPPVNSTE-YNTLCPGGEGFRPNPITIILEDIDECQE  1447
             G+S+   CC ++G +WG N C+ CP   S   YN +     G++        +DI+ECQ 
Sbjct  574   GLSKQEDCCGTVGTSWGFNKCQKCPKKPSYHGYNQMMECLPGYK-RVNNTFCQDINECQ-  631

Query  1448  LPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCG--PGTCYNTLGN  1505
             L G+C  G C+NT GS++C C  G+              CV  P V     G CY  + +
Sbjct  632   LQGVCPNGECLNTMGSYRCTCKIGFGPDP------TFSSCVPDPPVISEEKGPCYRLVSS  685

Query  1506  YTCICPPEYMQVNGGHNCMDMRKSF---CYR-SYNGTSCENEL-------PFNVTKRMCC  1554
                   P  + +     C  + K++   C +    GT+   E+         +   R   
Sbjct  686   GRQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGYTVSGVHRRRP  745

Query  1555  CTYNVGK--AWNKP---------CEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDEC  1603
               ++VGK   + KP           P P P   E       +   TF    G  V   E 
Sbjct  746   IHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEE------PVEALTFSREHGPGVAEPEV  799

Query  1604  ------KEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNAD  1657
                   KEIP +        ++   + +   G S   L      + E ++     +   +
Sbjct  800   ATAPPEKEIPSLDQEKT---KLEPGQPQLSPGISTIHLHPQFPVVIEKTSPPVPVEVAPE  856

Query  1658  CINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKAS  1717
                S        +A   ++P     + NEC   P++C  G C+++   Y CIC+ G++ S
Sbjct  857   ASTS--------SASQVIAPTQV-TEINECTVNPDICGAGHCINLPVRYTCICYEGYRFS  907

Query  1718  QDQTMCMDVDECER--HPCGNGTCKNTVGSYNCLCYPGFELTHN-NDCMDIDECSSFFGQ  1774
             + Q  C+D+DEC +  H C  G C+NT GS+ C+C  GF  +    +C+D+DEC      
Sbjct  908   EQQRKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDEC--LRPD  965

Query  1775  VCRNGRCFNEIGSFKC-LCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCI  1833
             VC  G C N +G+F+C  C+ GY +T  G+ C D +EC+  P +C    C N  GS++C+
Sbjct  966   VCGEGHCVNTVGAFRCEYCDSGYRMTQRGR-CEDIDECLN-PSTCPDEQCVNSPGSYQCV  1023

Query  1834  -CPPGYEVKSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQ  1892
              C  G+   +  C+D++EC E PN+C  G C+N  G + C C  G+  + + + C D  +
Sbjct  1024  PCTEGFRGWNGQCLDVDECLE-PNVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDE  1082

Query  1893  SFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGT  1952
                     NG+C                               K  E +F+  C  G+  
Sbjct  1083  CQQGNLCVNGQC-------------------------------KNTEGSFRCTCGQGY-Q  1110

Query  1953  IPGIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDEC-SIG  2011
             +    D  ED++EC +   +C++G C NT+GSF+C C  GY     G HC D +EC    
Sbjct  1111  LSAAKDQCEDIDEC-QHRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDK  1169

Query  2012  NPCGNGTCTNVIGSFECNCHEGFE  2035
             + C  G C N  GS++C C +GF+
Sbjct  1170  SVCQRGDCINTAGSYDCTCPDGFQ  1193


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 106/404 (26%), Positives = 156/404 (39%), Gaps = 79/404 (20%)

Query  7     CFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCP---------AQPQPCRRGFI  57
             C+  +N+      +     TK  CC T G  WG  CE+ P          +  P  +GF+
Sbjct  1349  CYYNLNDASLCDNVLAPNVTKQECCCTSGVGWGDNCEIFPCPVLGTAEFTEMCPKGKGFV  1408

Query  58    PNIRTGA------CQDVDECQAI-PGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDI  110
             P   + +       +D DEC      +C+ G C+NT   YEC C  G   +    +C D+
Sbjct  1409  PAGESSSEAGGENYKDADECLLFGQEICKNGFCLNTRPGYECYCKQGTYYDPVKLQCFDM  1468

Query  111   DECSIIPGICEGSECSNTVGSYFCICPRGYVTSTDGSRCI------------DQRASTCF  158
             DEC   P  C   +C NT GSY C C    V      RCI            D     C+
Sbjct  1469  DECQD-PSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAESNEQIEETDVYQDLCW  1527

Query  159   SNIVNGR-CAQELPGRFTK-RQCCCESGRCWAMGSVPEMCPVRGSDEYRRLCVDGAPAGG  216
              ++ +   C++ L G+ T   +CCC  G  W M     +CP++ SD+Y +LC    P  G
Sbjct  1528  EHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGMQCA--LCPLKDSDDYAQLC--NIPVTG  1583

Query  217   GSRGGGTGGNGFLPSGNGNGHGHGPRGAGFIPIPGSNGFSPGVGGAGVGTGSSTGNGPII  276
               +                     P G   + +  S  ++P                P  
Sbjct  1584  RRQ---------------------PYGRDAL-VDFSEQYTPEAD-------------PYF  1608

Query  277   TGLTILNQTIDICKHHPDL---CLNGRCIPTLSSYRCECNMGYKQD-SNGDCTDVDECTS  332
                  LN   ++      +   C NGRC+     Y C+C  GY  D +   C DV+EC  
Sbjct  1609  IQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDE  1668

Query  333   -----NPCSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECI  371
                  + C N  C+NT GSY C C  G+  +     C  ++  +
Sbjct  1669  LNNRMSLCKNAKCINTDGSYKCLCLPGYVPSDKPNYCTPLNTAL  1712


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 80/168 (48%), Gaps = 13/168 (8%)

Query  736  FARVNGVTCEDVNECDVFPG---VCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRME  792
             +R++G T +   E    PG   V   G  +    + H        +     V    ++ 
Sbjct  500  VSRIDGPTGQKTKEAQ--PGQSQVSYQGLPVQKTQTIHSTYSHQQVIPHVYPVAAKTQLG  557

Query  793  QCYLTWDEDECIRSVPGKFRMDACCCAVGAAWG-SDCEECPK-PDTKEYEALCPRGPGFS  850
            +C+      +C +++PG  + + CC  VG +WG + C++CPK P    Y  +    PG+ 
Sbjct  558  RCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPSYHGYNQMMECLPGYK  617

Query  851  NRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLD  898
               +      F +DINEC++  G+C NG+C NT+GS++C C  GF  D
Sbjct  618  RVNNT-----FCQDINECQL-QGVCPNGECLNTMGSYRCTCKIGFGPD  659


 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query  1962  DVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGNGTCTN  2021
             D++EC +   +CS G C NT+GSF C CP G+     G +CID DEC   + CG G C N
Sbjct  915   DIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVN  974

Query  2022  VIGSFECN-CHEGFEPGPMMNCE  2043
              +G+F C  C  G+       CE
Sbjct  975   TVGAFRCEYCDSGYRMTQRGRCE  997


 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 50/91 (55%), Gaps = 9/91 (10%)

Query  333   NPCSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDEC--IQNGV-LCKNGRCVNTDGSF  389
             N C NG CV     Y C C  G+     K  C+D++EC  + N + LCKN +C+NTDGS+
Sbjct  1629  NGCENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAKCINTDGSY  1688

Query  390   QCICNAGFELTTDGKNCVDHDECTTTNMCLN  420
             +C+C  G+ + +D  N      CT  N  LN
Sbjct  1689  KCLCLPGY-VPSDKPN-----YCTPLNTALN  1713


> sp|Q14767|LTBP2_HUMAN Latent-transforming growth factor beta-binding 
protein 2 OS=Homo sapiens GN=LTBP2 PE=1 SV=3
Length=1821

 Score = 395 bits (1015),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 346/1089 (32%), Positives = 490/1089 (45%), Gaps = 177/1089 (16%)

Query  685   LKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWG----SPC---------ERCELDTA  731
             L G C+LN  + +C   +   T + +CC ++GA WG    +PC         E  +L+  
Sbjct  550   LLGRCYLNTVNGQCANPLLELTTQEDCCGSVGAFWGVTLCAPCPPRPASPVIENGQLE--  607

Query  732   CSRGFARVNGVTCEDVNECDVFPGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLD---  788
             C +G+ R+N   C+D+NEC    G+C +  C+N+RGS+ C C  GL LD +   C+    
Sbjct  608   CPQGYKRLNLTHCQDINECLTL-GLCKDAECVNTRGSYLCTCRPGLMLDPSRSRCVSDKA  666

Query  789   IRMEQ--CYLTWDEDECIRSVPGKFRMDACCCA-VGAAWGSDCEECPKPDTKEYEALCPR  845
             I M Q  CY +     C   +  +     CCC+ VG AWGS+CE+CP P T+ +  +CP 
Sbjct  667   ISMLQGLCYRSLGPGTCTLPLAQRITKQICCCSRVGKAWGSECEKCPLPGTEAFREICPA  726

Query  846   GPGFS-NRGDI-----------LTGRPFYKDINECKVFPGMCMNGKCRNTI------GSF  887
             G G++    DI           L   P  +        PG       R         G+ 
Sbjct  727   GHGYTYASSDIRLSMRKAEEEELARPPREQGQRSSGALPGPAERQPLRVVTDTWLEAGTI  786

Query  888   KCKCNS-------------------GFTLDMEERNCTDIDECWISP--------------  914
               K +S                     T  M E+   +I E  ++P              
Sbjct  787   PDKGDSQAGQVTTSVTHAPAWVTGNATTPPMPEQGIAEIQEEQVTPSTDVLVTLSTPGID  846

Query  915   -------DLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRG-GTCV  966
                    ++CG GTCVN P  + C C  GY+        C D +EC R+P  C+G G C+
Sbjct  847   RCAAGATNVCGPGTCVNLPDGYRCVCSPGYQL-HPSQAYCTDDNECLRDP--CKGKGRCI  903

Query  967   NTEGSFQCDCPLGHELSPS--REECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQA  1024
             N  GS+ C C  G+ L+ S   +EC D+NEC     +C  G+C N  G+Y C C+ GY  
Sbjct  904   NRVGSYSCFCYPGYTLATSGATQECQDINECE-QPGVCSGGQCTNTEGSYHCECDQGYIM  962

Query  1025  TPDRRSCTDIDECMIMNGGCHTHCTNSEGSYEC-SCSDGYALMPDVRTCADIDECESNPD  1083
                +  C DI+EC          C NS GSY C +C +GY       +C D++EC + P 
Sbjct  963   V-RKGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEGYRGQSG--SCVDVNECLT-PG  1018

Query  1084  ICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICH-  1142
             +C  G+CTN+ G +RC C  G+  + D K C DV+EC   ++ C  G C NT+GSF C  
Sbjct  1019  VCAHGKCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRAS-CPTGLCLNTEGSFACSA  1077

Query  1143  CQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCS-CREGWVGN--GIKCID  1199
             C+ GY V +  T C D+DEC            C N  GSF C  C  G+  +  G  C D
Sbjct  1078  CENGYWVNEDGTACEDLDECAFPG--VCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCED  1135

Query  1200  LDECSNGTHQCSVNAQCVNSPGSYLCACVEGFT-GDGFTCSDVDECAENVHLCENGQCLN  1258
             +DEC +    C +  +C N+ GSY C C +GF   +G  C DV+EC    H   +G+CLN
Sbjct  1136  VDECEDPQSSC-LGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHGECLN  1194

Query  1259  VPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYELDRTG  1318
               G++ C C  GF  A    SCQD++EC+  + CV G C N  G F+C+C+ G++     
Sbjct  1195  SHGSFFCLCAPGFVSAEGGTSCQDVDECATTDPCVGGHCVNTEGSFNCLCETGFQPSPES  1254

Query  1319  GNCTDVDEC---ADPINCVNGLCVNTPGRYEC--NCPPDFQLNPTGVGCVDNRVGNCYLK  1373
             G C D+DEC    DP+ C    C N+PG Y C   C P F + P G  C+D  +  C   
Sbjct  1255  GECVDIDECEDYGDPV-CGTWKCENSPGSYRCVLGCQPGFHMAPNG-DCID--IDEC---  1307

Query  1374  YGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPN  1433
                                +  + C S G             ++T+ +  C   +GF  +
Sbjct  1308  -------------------ANDTMCGSHGF-----------CDNTDGSFRCLCDQGFEIS  1337

Query  1434  PITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGV  1493
             P      D++EC+ +  +C    C N  GSF C C              D++E  A  G 
Sbjct  1338  PSGWDCVDVNECELMLAVCGAALCENVEGSFLCLC------------ASDLEEYDAQEGH  1385

Query  1494  CGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTS-CENELPFNVTKRM  1552
             C P       G      P       G H     R   CY    G + C + L  N T+  
Sbjct  1386  CRP---RGAGGQSMSEAP------TGDHAPAPTRMD-CYSGQKGHAPCSSVLGRNTTQAE  1435

Query  1553  CCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGF-----TFDIHSGKAVDIDECKEI-  1606
             CCCT   G +W   C+ CP+  +AEF  IC +  G+      +        D DEC    
Sbjct  1436  CCCTQ--GASWGDACDLCPSEDSAEFSEICPSGKGYIPVEGAWTFGQTMYTDADECVIFG  1493

Query  1607  PGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYR  1666
             PG+C NG C+N +  + C C  GF Y+     CED DEC    +L   N +C+N+ GS+ 
Sbjct  1494  PGLCPNGRCLNTVPGYVCLCNPGFHYDASHKKCEDHDEC---QDLACENGECVNTEGSFH  1550

Query  1667  CECAAGFKL  1675
             C C+    L
Sbjct  1551  CFCSPPLTL  1559


 Score = 395 bits (1014),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 316/938 (34%), Positives = 451/938 (48%), Gaps = 88/938 (9%)

Query  877   NGKCRNTIGSFKCKCNSGFTLDME--ERNCTDIDECWISPDLCGSGTCVNTPGSFECECF  934
              G+C N +GS+ C C  G+TL      + C DI+EC   P +C  G C NT GS+ CEC 
Sbjct  899   KGRCINRVGSYSCFCYPGYTLATSGATQECQDINEC-EQPGVCSGGQCTNTEGSYHCECD  957

Query  935   DGYESGFMMMK-NCMDIDECERNPLLCRGGTCVNTEGSFQC-DCPLGHELSPSREECIDV  992
              GY    M+ K +C DI+EC R+P  C  G CVN+ GS+ C  C  G+        C+DV
Sbjct  958   QGY---IMVRKGHCQDINEC-RHPGTCPDGRCVNSPGSYTCLACEEGYRGQSG--SCVDV  1011

Query  993   NECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSE  1052
             NEC L+  +C +GKC N+ G+++CSC  GY+ T D + C D+DEC          C N+E
Sbjct  1012  NEC-LTPGVCAHGKCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPTGLCLNTE  1070

Query  1053  GSYECS-CSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCL-CYDGFMASMD  1110
             GS+ CS C +GY +  D   C D+DEC + P +C  G CTN  G + C  C  G+  S  
Sbjct  1071  GSFACSACENGYWVNEDGTACEDLDEC-AFPGVCPSGVCTNTAGSFSCKDCDGGYRPSPL  1129

Query  1111  MKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCD  1170
               +C DV+EC+   + C+ GEC+NT GS+ C C  G+ +  GT  C DV+EC +G  +C 
Sbjct  1130  GDSCEDVDECEDPQSSCLGGECKNTVGSYQCLCPQGFQLANGTV-CEDVNEC-MGEEHCA  1187

Query  1171  MHASCVNVPGSFKCSCREGWVG--NGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACV  1228
              H  C+N  GSF C C  G+V    G  C D+DEC+  T  C V   CVN+ GS+ C C 
Sbjct  1188  PHGECLNSHGSFFCLCAPGFVSAEGGTSCQDVDECAT-TDPC-VGGHCVNTEGSFNCLCE  1245

Query  1229  EGF--TGDGFTCSDVDECAE-NVHLCENGQCLNVPGAYRCE--CEMGFTPASDSKSCQDI  1283
              GF  + +   C D+DEC +    +C   +C N PG+YRC   C+ GF  A +   C DI
Sbjct  1246  TGFQPSPESGECVDIDECEDYGDPVCGTWKCENSPGSYRCVLGCQPGFHMAPNGD-CIDI  1304

Query  1284  NECSFQNIC-VFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDECADPIN-CVNGLCVNT  1341
             +EC+   +C   G C+N  G F C+CD G+E+  +G +C DV+EC   +  C   LC N 
Sbjct  1305  DECANDTMCGSHGFCDNTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENV  1364

Query  1342  PGRYECNCPPDFQLNPTGVG-CVDNRVGNCYLKYGPRGD---------------GSLSCN  1385
              G + C C  D +      G C     G   +   P GD               G   C+
Sbjct  1365  EGSFLCLCASDLEEYDAQEGHCRPRGAGGQSMSEAPTGDHAPAPTRMDCYSGQKGHAPCS  1424

Query  1386  TEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNPIT-----IILE  1440
             + +G   +++ CCC+ G +WG+ C+ CP  +S E++ +CP G+G+ P          +  
Sbjct  1425  SVLGRNTTQAECCCTQGASWGDACDLCPSEDSAEFSEICPSGKGYIPVEGAWTFGQTMYT  1484

Query  1441  DIDECQEL-PGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTC  1499
             D DEC    PGLC  G C+NT   + C C  G++     + CED DEC      C  G C
Sbjct  1485  DADECVIFGPGLCPNGRCLNTVPGYVCLCNPGFHYDASHKKCEDHDEC--QDLACENGEC  1542

Query  1500  YNTLGNYTCICPPEYMQVNGGHNCM------------DMRKSFCYRSYNGTSCENELPFN  1547
              NT G++ C C P          CM            D+    C++      C   L  +
Sbjct  1543  VNTEGSFHCFCSPPLTLDLSQQRCMNSTSSTEDLPDHDIHMDICWKKVTNDVCSEPLRGH  1602

Query  1548  VTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIP  1607
              T    CC  + G+AW++ C  CP   +  +  +C N+     +  +G  V      E  
Sbjct  1603  RTTYTECCCQD-GEAWSQQCALCPPRSSEVYAQLC-NVARIEAEREAG--VHFRPGYEY-  1657

Query  1608  GICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCIN------S  1661
             G   + +  +  G      P G  + + L   + + E +   N    +AD          
Sbjct  1658  GPGPDDLHYSIYG------PDGAPFYNYLGPEDTVPEPAF-PNTAGHSADRTPILESPLQ  1710

Query  1662  PGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQT  1721
             P   +    A     P G    + E   I N C +G CV ++  Y C C  GF+      
Sbjct  1711  PSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVRVREGYTCDCFEGFQLDAAHM  1770

Query  1722  MCMDVDECE-----RHPCGNGTCKNTVGSYNCLCYPGF  1754
              C+DV+EC+        C +G C+NT GSY C C PG+
Sbjct  1771  ACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGY  1808


 Score = 323 bits (829),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 335/1146 (29%), Positives = 477/1146 (42%), Gaps = 162/1146 (14%)

Query  380   GRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLN-----GMCINEDGSFKCIC  434
             GRC     + QC  N   ELTT    C          +C          + E+G  +C  
Sbjct  552   GRCYLNTVNGQCA-NPLLELTTQEDCCGSVGAFWGVTLCAPCPPRPASPVIENGQLEC--  608

Query  435   KPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCECPPGLAVGVDGRVCVD----  490
              P      N  +C DI+EC T G+C +  C+NT GS+ C C PGL +      CV     
Sbjct  609   -PQGYKRLNLTHCQDINECLTLGLCKDAECVNTRGSYLCTCRPGLMLDPSRSRCVSDKAI  667

Query  491   THMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGLCSSG  550
             + ++  CY  +  G C  P    +TK  CCC+     +G  C  CP   +  F  +C +G
Sbjct  668   SMLQGLCYRSLGPGTCTLPLAQRITKQICCCSRVGKAWGSECEKCPLPGTEAFREICPAG  727

Query  551   IGITVDGRDINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDI--DECSVN  608
              G T    DI       +          +G      +SG  P P+ R  + +  D     
Sbjct  728   HGYTYASSDIRLSMRKAEEEELARPPREQGQR----SSGALPGPAERQPLRVVTDTWLEA  783

Query  609   RLLCDNGLCRNTPGSYSCTCPKGYVFSTETDT------CEDINECESSP-----------  651
               + D G  +    + S T    +V    T          +I E + +P           
Sbjct  784   GTIPDKGDSQAGQVTTSVTHAPAWVTGNATTPPMPEQGIAEIQEEQVTPSTDVLVTLSTP  843

Query  652   ------------CVNGACRNNLGSFNCECSPGSKLDSTGLICIDS---LKGTCWLNIQDS  696
                         C  G C N    + C CSPG +L  +   C D    L+  C       
Sbjct  844   GIDRCAAGATNVCGPGTCVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLRDPC-------  896

Query  697   RCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRGFA-RVNGVT--CEDVNECDVF  753
                        K  C   +G+              C  G+    +G T  C+D+NEC+  
Sbjct  897   ---------KGKGRCINRVGS----------YSCFCYPGYTLATSGATQECQDINECEQ-  936

Query  754   PGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRM  813
             PGVC  G+C N+ GS+HCEC +G  +   G  C DI   +   T  +  C+ S PG +  
Sbjct  937   PGVCSGGQCTNTEGSYHCECDQGYIMVRKGH-CQDINECRHPGTCPDGRCVNS-PGSYTC  994

Query  814   DACCCAVGAAWGS--DCEECPKPDTKEYEALCPRGPGFSNRG----------DILTGRPF  861
              AC        GS  D  EC  P       +C  G   +  G          ++ +    
Sbjct  995   LACEEGYRGQSGSCVDVNECLTP------GVCAHGKCTNLEGSFRCSCEQGYEVTSDEKG  1048

Query  862   YKDINECKVFPGMCMNGKCRNTIGSFKCK-CNSGFTLDMEERNCTDIDECWISPDLCGSG  920
              +D++EC      C  G C NT GSF C  C +G+ ++ +   C D+DEC   P +C SG
Sbjct  1049  CQDVDECASR-ASCPTGLCLNTEGSFACSACENGYWVNEDGTACEDLDECAF-PGVCPSG  1106

Query  921   TCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGH  980
              C NT GSF C+  DG      +  +C D+DECE     C GG C NT GS+QC CP G 
Sbjct  1107  VCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECEDPQSSCLGGECKNTVGSYQCLCPQGF  1166

Query  981   ELSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIM  1040
             +L+ +   C DVNEC   +    +G+C+N  G++ C C  G+ +     SC D+DEC   
Sbjct  1167  QLA-NGTVCEDVNECMGEEHCAPHGECLNSHGSFFCLCAPGFVSAEGGTSCQDVDECATT  1225

Query  1041  NGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPD-ICDGGQCTNIPGEYRC  1099
             +     HC N+EGS+ C C  G+   P+   C DIDECE   D +C   +C N PG YRC
Sbjct  1226  DPCVGGHCVNTEGSFNCLCETGFQPSPESGECVDIDECEDYGDPVCGTWKCENSPGSYRC  1285

Query  1100  L--CYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCT  1157
             +  C  GF  + +   CID++EC  ++     G C+NT GSF C C  G+ +      C 
Sbjct  1286  VLGCQPGFHMAPN-GDCIDIDECANDTMCGSHGFCDNTDGSFRCLCDQGFEISPSGWDCV  1344

Query  1158  DVDECEIGAHNCDMHASCVNVPGSFKCSC---------REGW-VGNGIKCIDLDECSNGT  1207
             DV+ECE+    C   A C NV GSF C C         +EG     G     + E   G 
Sbjct  1345  DVNECELMLAVCGA-ALCENVEGSFLCLCASDLEEYDAQEGHCRPRGAGGQSMSEAPTGD  1403

Query  1208  HQCS------VNAQCVNSPGSYL---------CACVEGFT-GDGFTCSDVDECAENVHLC  1251
             H  +       + Q  ++P S +         C C +G + GD       ++ AE   +C
Sbjct  1404  HAPAPTRMDCYSGQKGHAPCSSVLGRNTTQAECCCTQGASWGDACDLCPSEDSAEFSEIC  1463

Query  1252  ENGQ-CLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDD  1310
              +G+  + V GA+      G T  +D+  C          +C  G C N    + C+C+ 
Sbjct  1464  PSGKGYIPVEGAW----TFGQTMYTDADECVIFGP----GLCPNGRCLNTVPGYVCLCNP  1515

Query  1311  GYELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCV-------  1363
             G+  D +   C D DEC D + C NG CVNT G + C C P   L+ +   C+       
Sbjct  1516  GFHYDASHKKCEDHDECQD-LACENGECVNTEGSFHCFCSPPLTLDLSQQRCMNSTSSTE  1574

Query  1364  -----DNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNST  1418
                  D  +  C+ K        +      G   + + CCC  G+AW   C  CPP +S 
Sbjct  1575  DLPDHDIHMDICWKKV----TNDVCSEPLRGHRTTYTECCCQDGEAWSQQCALCPPRSSE  1630

Query  1419  EYNTLC  1424
              Y  LC
Sbjct  1631  VYAQLC  1636


 Score = 311 bits (797),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 399/1414 (28%), Positives = 549/1414 (39%), Gaps = 286/1414 (20%)

Query  5     GPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHP-CEMCPAQPQPCRRGFIPNIRTG  63
             G C+    N  C   L  +  T+  CC ++G  WG   C  CP +P        P I  G
Sbjct  552   GRCYLNTVNGQCANPLLELT-TQEDCCGSVGAFWGVTLCAPCPPRPA------SPVIENG  604

Query  64    ACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICEGS  123
                                        + +CP G+K+   T  C DI+EC  + G+C+ +
Sbjct  605   ---------------------------QLECPQGYKRLNLTH-CQDINECLTL-GLCKDA  635

Query  124   ECSNTVGSYFCICPRGYVTSTDGSRCIDQRAST-----CFSNIVNGRCAQELPGRFTKRQ  178
             EC NT GSY C C  G +     SRC+  +A +     C+ ++  G C   L  R TK+ 
Sbjct  636   ECVNTRGSYLCTCRPGLMLDPSRSRCVSDKAISMLQGLCYRSLGPGTCTLPLAQRITKQI  695

Query  179   CCCES-GRCWAMGSVPEMCPVRGSDEYRRLCVDGAPAGGGSRGGGTGGNGFLPSGNGNGH  237
             CCC   G+ W  GS  E CP+ G++ +R +C    PAG G     +     +        
Sbjct  696   CCCSRVGKAW--GSECEKCPLPGTEAFREIC----PAGHGYTYASSDIRLSMRKAEEEEL  749

Query  238   GHGPR-----GAGFIPIPGSN-------------GFSPGVGGAGVG--TGSSTGNGPIIT  277
                PR      +G +P P                G  P  G +  G  T S T     +T
Sbjct  750   ARPPREQGQRSSGALPGPAERQPLRVVTDTWLEAGTIPDKGDSQAGQVTTSVTHAPAWVT  809

Query  278   G---------------------------LTILNQTIDICKH-HPDLCLNGRCIPTLSSYR  309
             G                           +T+    ID C     ++C  G C+     YR
Sbjct  810   GNATTPPMPEQGIAEIQEEQVTPSTDVLVTLSTPGIDRCAAGATNVCGPGTCVNLPDGYR  869

Query  310   CECNMGYK-QDSNGDCTDVDECTSNPCS-NGDCVNTPGSYYCKCHAGFQRTPT--KQACI  365
             C C+ GY+   S   CTD +EC  +PC   G C+N  GSY C C+ G+    +   Q C 
Sbjct  870   CVCSPGYQLHPSQAYCTDDNECLRDPCKGKGRCINRVGSYSCFCYPGYTLATSGATQECQ  929

Query  366   DIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCIN  425
             DI+EC Q GV C  G+C NT+GS+ C C+ G+ +   G +C D +EC     C +G C+N
Sbjct  930   DINECEQPGV-CSGGQCTNTEGSYHCECDQGYIMVRKG-HCQDINECRHPGTCPDGRCVN  987

Query  426   EDGSFKCI-CKPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCECPPGLAVGVD  484
               GS+ C+ C+ G+        C D++EC T G+C +G C N EGSFRC C  G  V  D
Sbjct  988   SPGSYTCLACEEGYRGQSGS--CVDVNECLTPGVCAHGKCTNLEGSFRCSCEQGYEVTSD  1045

Query  485   GRVCVDT---HMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSA  541
              + C D      R++C  G+                   C N +  F      C A    
Sbjct  1046  EKGCQDVDECASRASCPTGL-------------------CLNTEGSFA-----CSA----  1077

Query  542   EFHGLCSSGIGITVDG---RDINECALDPDICSNGICENLRGSYRC-NCNSGYEPDPSGR  597
                  C +G  +  DG    D++ECA  P +C +G+C N  GS+ C +C+ GY P P G 
Sbjct  1078  -----CENGYWVNEDGTACEDLDECAF-PGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGD  1131

Query  598   NCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINEC--ESSPCVNG  655
             +C D+DEC   +  C  G C+NT GSY C CP+G+  +  T  CED+NEC  E     +G
Sbjct  1132  SCEDVDECEDPQSSCLGGECKNTVGSYQCLCPQGFQLANGT-VCEDVNECMGEEHCAPHG  1190

Query  656   ACRNNLGSFNCECSPGSKLDSTGLICIDS---------LKGTCWLNIQDS---RCEVNIN  703
              C N+ GSF C C+PG      G  C D          + G C +N + S    CE    
Sbjct  1191  ECLNSHGSFFCLCAPGFVSAEGGTSCQDVDECATTDPCVGGHC-VNTEGSFNCLCETGFQ  1249

Query  704   GATLKSEC-------------CATLGAAWGSPCERCELDTACSRGFARVNGVTCEDVNEC  750
              +    EC             C T          RC L   C  GF       C D++EC
Sbjct  1250  PSPESGECVDIDECEDYGDPVCGTWKCENSPGSYRCVL--GCQPGFHMAPNGDCIDIDEC  1307

Query  751   DVFPGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGK  810
                     +G C N+ GSF C C +G  +  +G  C+D+   +  L         +V G 
Sbjct  1308  ANDTMCGSHGFCDNTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGS  1367

Query  811   FRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDILTG----RPFYKDIN  866
             F    C CA      SD EE    D +E     PRG G  +  +  TG     P   D  
Sbjct  1368  F---LCLCA------SDLEEY---DAQEGHCR-PRGAGGQSMSEAPTGDHAPAPTRMDCY  1414

Query  867   ECKVFPGMCMNGKCRNTI------------------------GSFKCKCNSGF-------  895
               +     C +   RNT                           F   C SG        
Sbjct  1415  SGQKGHAPCSSVLGRNTTQAECCCTQGASWGDACDLCPSEDSAEFSEICPSGKGYIPVEG  1474

Query  896   TLDMEERNCTDIDECWI-SPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECE  954
                  +   TD DEC I  P LC +G C+NT   + C C  G+       K C D DEC+
Sbjct  1475  AWTFGQTMYTDADECVIFGPGLCPNGRCLNTVPGYVCLCNPGFHYD-ASHKKCEDHDECQ  1533

Query  955   RNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTY  1014
                L C  G CVNTEGSF C C     L  S++ C+  N  S ++ L             
Sbjct  1534  D--LACENGECVNTEGSFHCFCSPPLTLDLSQQRCM--NSTSSTEDL-------------  1576

Query  1015  QCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSY-ECSCSDGYALMPDVRTCA  1073
                        PD     DI    + N  C         +Y EC C DG A       C 
Sbjct  1577  -----------PDHDIHMDICWKKVTNDVCSEPLRGHRTTYTECCCQDGEAWSQQCALCP  1625

Query  1074  DIDECESNPDICDGG--QCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGE  1131
                  E    +C+    +     G +    Y+      D+   I   +    +    +  
Sbjct  1626  PRSS-EVYAQLCNVARIEAEREAGVHFRPGYEYGPGPDDLHYSIYGPD---GAPFYNYLG  1681

Query  1132  CENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWV  1191
              E+T          G+S  +     + +   E+  H    H      P  F     EG  
Sbjct  1682  PEDTVPEPAFPNTAGHSADRTPILESPLQPSELQPHYVASHP---EPPAGF-----EGLQ  1733

Query  1192  GNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDG--FTCSDVDECAE---  1246
                 +C  L+ C NG        +CV     Y C C EGF  D     C DV+EC +   
Sbjct  1734  AE--ECGILNGCENG--------RCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNG  1783

Query  1247  NVHLCENGQCLNVPGAYRCECEMGFTPASDSKSC  1280
                LC +G C N  G+YRC C  G+   +    C
Sbjct  1784  PAVLCVHGYCENTEGSYRCHCSPGYVAEAGPPHC  1817


 Score = 306 bits (784),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 255/766 (33%), Positives = 362/766 (47%), Gaps = 106/766 (14%)

Query  1314  LDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLK  1373
             +DR     T+V        C  G CVN P  Y C C P +QL+P+   C D+   N  L+
Sbjct  845   IDRCAAGATNV--------CGPGTCVNLPDGYRCVCSPGYQLHPSQAYCTDD---NECLR  893

Query  1374  YGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPN  1433
                +G G   C   +G                              Y+  C  G     +
Sbjct  894   DPCKGKGR--CINRVG-----------------------------SYSCFCYPGYTLATS  922

Query  1434  PITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGV  1493
               T   +DI+EC++ PG+C GG C NT GS+ CEC +GY +  +   C+DI+EC  HPG 
Sbjct  923   GATQECQDINECEQ-PGVCSGGQCTNTEGSYHCECDQGYIMVRKGH-CQDINEC-RHPGT  979

Query  1494  CGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSF---------CYRSYNGTSCENEL  1544
             C  G C N+ G+YTC+   E  +   G +C+D+ +           C        C  E 
Sbjct  980   CPDGRCVNSPGSYTCLACEEGYRGQSG-SCVDVNECLTPGVCAHGKCTNLEGSFRCSCEQ  1038

Query  1545  PFNVTKRMCCCTYNVGKAWNKPCEPCPT----PGTAEFK-NICGNIPGFTFDIHSGKAVD  1599
              + VT     C  +V +  ++    CPT         F  + C N  G+  +       D
Sbjct  1039  GYEVTSDEKGCQ-DVDECASR--ASCPTGLCLNTEGSFACSACEN--GYWVNEDGTACED  1093

Query  1600  IDECKEIPGICANGVCINQIGSFRC-ECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADC  1658
             +DEC   PG+C +GVC N  GSF C +C  G+  + L   CED+DEC +  + C    +C
Sbjct  1094  LDECA-FPGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECEDPQSSC-LGGEC  1151

Query  1659  INSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQ  1718
              N+ GSY+C C  GF+L+    C D NEC+   +   HG C++  GS+ C+C  GF +++
Sbjct  1152  KNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHGECLNSHGSFFCLCAPGFVSAE  1211

Query  1719  DQTMCMDVDECE-RHPCGNGTCKNTVGSYNCLCYPGFELT-HNNDCMDIDECSSFFGQVC  1776
               T C DVDEC    PC  G C NT GS+NCLC  GF+ +  + +C+DIDEC  +   VC
Sbjct  1212  GGTSCQDVDECATTDPCVGGHCVNTEGSFNCLCETGFQPSPESGECVDIDECEDYGDPVC  1271

Query  1777  RNGRCFNEIGSFKCL--CNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCIC  1834
                +C N  GS++C+  C  G+ +  +G +CID +EC       S G C N +GSFRC+C
Sbjct  1272  GTWKCENSPGSYRCVLGCQPGFHMAPNG-DCIDIDECANDTMCGSHGFCDNTDGSFRCLC  1330

Query  1835  PPGYEVKSE--SCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSD----------  1882
               G+E+      C+D+NEC     +C    C N  G F C+C +     D          
Sbjct  1331  DQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYDAQEGHCRPRG  1390

Query  1883  ----------NGRRCFDTRQSFCFTNFE-NGKCSVPKAFNTTKAKCCCSKMPGEGWGDPC  1931
                        G       +  C++  + +  CS     NTT+A+CCC++  G  WGD C
Sbjct  1391  AGGQSMSEAPTGDHAPAPTRMDCYSGQKGHAPCSSVLGRNTTQAECCCTQ--GASWGDAC  1448

Query  1932  ELCPKEEEVAFQDLCPYGHGTIPGI------DDTREDVNEC-LESPGVCSNGHCINTDGS  1984
             +LCP E+   F ++CP G G IP             D +EC +  PG+C NG C+NT   
Sbjct  1449  DLCPSEDSAEFSEICPSGKGYIPVEGAWTFGQTMYTDADECVIFGPGLCPNGRCLNTVPG  1508

Query  1985  FRCECPMGYNLDYTGVHCIDTDECSIGNPCGNGTCTNVIGSFECNC  2030
             + C C  G++ D +   C D DEC     C NG C N  GSF C C
Sbjct  1509  YVCLCNPGFHYDASHKKCEDHDECQ-DLACENGECVNTEGSFHCFC  1553


 Score = 291 bits (745),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 289/991 (29%), Positives = 410/991 (41%), Gaps = 185/991 (19%)

Query  1159  VDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIK--CIDLDECSNGTHQCSVNAQC  1216
             +D C  GA N     +CVN+P  ++C C  G+  +  +  C D +EC      C    +C
Sbjct  845   IDRCAAGATNVCGPGTCVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLRDP--CKGKGRC  902

Query  1217  VNSPGSYLCACVEGFT----GDGFTCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFT  1272
             +N  GSY C C  G+T    G    C D++EC E   +C  GQC N  G+Y CEC+ G+ 
Sbjct  903   INRVGSYSCFCYPGYTLATSGATQECQDINEC-EQPGVCSGGQCTNTEGSYHCECDQGYI  961

Query  1273  PASDSKSCQDINECSFQNICVFGTCNNLPGMFHCI-CDDGYELDRTGGNCTDVDECADPI  1331
                    CQDINEC     C  G C N PG + C+ C++GY      G+C DV+EC  P 
Sbjct  962   MVRKGH-CQDINECRHPGTCPDGRCVNSPGSYTCLACEEGYR--GQSGSCVDVNECLTPG  1018

Query  1332  NCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVG  1391
              C +G C N  G + C+C   +++     GC D  V  C  +         SC T + + 
Sbjct  1019  VCAHGKCTNLEGSFRCSCEQGYEVTSDEKGCQD--VDECASR--------ASCPTGLCLN  1068

Query  1392  VSRSSCC--CSLGKAWGNPCETCPPVNSTEYNTLCPGGE---------------GFRPNP  1434
                S  C  C  G         C  ++   +  +CP G                G+RP+P
Sbjct  1069  TEGSFACSACENGYWVNEDGTACEDLDECAFPGVCPSGVCTNTAGSFSCKDCDGGYRPSP  1128

Query  1435  ITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVC  1494
             +    ED+DEC++    C GG C NT GS+QC CP+G+ L+  T +CED++EC+      
Sbjct  1129  LGDSCEDVDECEDPQSSCLGGECKNTVGSYQCLCPQGFQLANGT-VCEDVNECMGEEHCA  1187

Query  1495  GPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCEN-ELPFNVTKRMC  1553
               G C N+ G++ C+C P ++   GG +C D+ +        G  C N E  FN     C
Sbjct  1188  PHGECLNSHGSFFCLCAPGFVSAEGGTSCQDVDECATTDPCVGGHCVNTEGSFN-----C  1242

Query  1554  CCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEI-PGICAN  1612
              C                               GF     SG+ VDIDEC++    +C  
Sbjct  1243  LCET-----------------------------GFQPSPESGECVDIDECEDYGDPVCGT  1273

Query  1613  GVCINQIGSFRCE--CPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECA  1670
               C N  GS+RC   C  GF +      C DIDEC+N D +C  +  C N+ GS+RC C 
Sbjct  1274  WKCENSPGSYRCVLGCQPGF-HMAPNGDCIDIDECAN-DTMCGSHGFCDNTDGSFRCLCD  1331

Query  1671  AGFKLSPNGA-CVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFK--------------  1715
              GF++SP+G  CVD NEC  +  VC   LC +++GS+ C+C +  +              
Sbjct  1332  QGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYDAQEGHCRPRGA  1391

Query  1716  --------ASQDQTMCMDVDECERHPCGNGTCKNTVG----SYNCLCYPGFELTHNNDCM  1763
                      + D        +C     G+  C + +G       C C  G       D  
Sbjct  1392  GGQSMSEAPTGDHAPAPTRMDCYSGQKGHAPCSSVLGRNTTQAECCCTQGASW---GDAC  1448

Query  1764  DI--DECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVAL-PGSCSP  1820
             D+   E S+ F ++C +G+ +  +        EG   T       D +ECV   PG C  
Sbjct  1449  DLCPSEDSAEFSEICPSGKGYIPV--------EG-AWTFGQTMYTDADECVIFGPGLCPN  1499

Query  1821  GTCQNLEGSFRCICPPG--YEVKSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGF  1878
             G C N    + C+C PG  Y+   + C D +EC +    C  G C NT G F C C    
Sbjct  1500  GRCLNTVPGYVCLCNPGFHYDASHKKCEDHDECQD--LACENGECVNTEGSFHCFCSPPL  1557

Query  1879  VLSDNGRRCF------------DTRQSFCFTNFENGKCSVP-KAFNTTKAKCCCSKMPGE  1925
              L  + +RC             D     C+    N  CS P +   TT  +CCC    GE
Sbjct  1558  TLDLSQQRCMNSTSSTEDLPDHDIHMDICWKKVTNDVCSEPLRGHRTTYTECCCQD--GE  1615

Query  1926  GWGDPCELCPKEEEVAFQDLCPY---------------GHGTIPGIDDTREDV-------  1963
              W   C LCP      +  LC                 G+   PG DD    +       
Sbjct  1616  AWSQQCALCPPRSSEVYAQLCNVARIEAEREAGVHFRPGYEYGPGPDDLHYSIYGPDGAP  1675

Query  1964  -------NECLESPGVC-SNGHCINTDGSFRCECPMG---YNLDYTGVHC--------ID  2004
                     + +  P    + GH  + D +   E P+        Y   H         + 
Sbjct  1676  FYNYLGPEDTVPEPAFPNTAGH--SADRTPILESPLQPSELQPHYVASHPEPPAGFEGLQ  1733

Query  2005  TDECSIGNPCGNGTCTNVIGSFECNCHEGFE  2035
              +EC I N C NG C  V   + C+C EGF+
Sbjct  1734  AEECGILNGCENGRCVRVREGYTCDCFEGFQ  1764


 Score = 266 bits (681),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 317/1036 (31%), Positives = 449/1036 (43%), Gaps = 127/1036 (12%)

Query  1048  CTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDG-GQCTNIPGEYRCLCYDGFM  1106
             C N    Y C CS GY L P    C D +EC  +P  C G G+C N  G Y C CY G+ 
Sbjct  861   CVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLRDP--CKGKGRCINRVGSYSCFCYPGYT  918

Query  1107  ASMDMKT--CIDVNECDLNSNICMFGECENTKGSFICHCQLGY-SVKKGTTGCTDVDECE  1163
              +    T  C D+NEC+    +C  G+C NT+GS+ C C  GY  V+KG   C D++EC 
Sbjct  919   LATSGATQECQDINECE-QPGVCSGGQCTNTEGSYHCECDQGYIMVRKGH--CQDINECR  975

Query  1164  IGAHNCDMHASCVNVPGSFKC-SCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGS  1222
                   D    CVN PGS+ C +C EG+ G    C+D++EC   T     + +C N  GS
Sbjct  976   HPGTCPD--GRCVNSPGSYTCLACEEGYRGQSGSCVDVNECL--TPGVCAHGKCTNLEGS  1031

Query  1223  YLCACVEGF--TGDGFTCSDVDECAENVHLCENGQCLNVPGAYRCE-CEMGFTPASDSKS  1279
             + C+C +G+  T D   C DVDECA     C  G CLN  G++ C  CE G+    D  +
Sbjct  1032  FRCSCEQGYEVTSDEKGCQDVDECASRAS-CPTGLCLNTEGSFACSACENGYWVNEDGTA  1090

Query  1280  CQDINECSFQNICVFGTCNNLPGMFHCI-CDDGYELDRTGGNCTDVDECADPIN-CVNGL  1337
             C+D++EC+F  +C  G C N  G F C  CD GY     G +C DVDEC DP + C+ G 
Sbjct  1091  CEDLDECAFPGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECEDPQSSCLGGE  1150

Query  1338  CVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKY--GPRGD-----GSLSCNTEIG-  1389
             C NT G Y+C CP  FQL   G  C D  V  C  +    P G+     GS  C    G 
Sbjct  1151  CKNTVGSYQCLCPQGFQLA-NGTVCED--VNECMGEEHCAPHGECLNSHGSFFCLCAPGF  1207

Query  1390  VGVSRSSCCCSLGK-AWGNPCETCPPVNST-EYNTLCPGGEGFRPNPITIILEDIDECQE  1447
             V     + C  + + A  +PC     VN+   +N LC    GF+P+P +    DIDEC++
Sbjct  1208  VSAEGGTSCQDVDECATTDPCVGGHCVNTEGSFNCLC--ETGFQPSPESGECVDIDECED  1265

Query  1448  L-PGLCQGGNCINTFGSFQCE--CPKGYYLSEETRICEDIDECVAHPGVCGP-GTCYNTL  1503
                 +C    C N+ GS++C   C  G++++     C DIDEC A+  +CG  G C NT 
Sbjct  1266  YGDPVCGTWKCENSPGSYRCVLGCQPGFHMAPNGD-CIDIDEC-ANDTMCGSHGFCDNTD  1323

Query  1504  GNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTS-CEN-ELPFNVTKRMCCCTYNVGK  1561
             G++ C+C   +     G +C+D+ +     +  G + CEN E  F     +C C  ++ +
Sbjct  1324  GSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSF-----LCLCASDLEE  1378

Query  1562  --AWNKPCEPCPTPGTAEFKNICG-NIPGFT-FDIHSGKAVDIDECKEIPGICANGVCIN  1617
               A    C P    G +  +   G + P  T  D +SG+      C  + G         
Sbjct  1379  YDAQEGHCRPRGAGGQSMSEAPTGDHAPAPTRMDCYSGQKGHAP-CSSVLG--------R  1429

Query  1618  QIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSP  1677
                   C C  G S+ D   +C   D         + +  C +  G    E A  F  + 
Sbjct  1430  NTTQAECCCTQGASWGDACDLCPSEDSA-------EFSEICPSGKGYIPVEGAWTFGQT-  1481

Query  1678  NGACVDRNECLEI-PNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPCGN  1736
                  D +EC+   P +C +G C++    Y C+C+ GF        C D DEC+   C N
Sbjct  1482  --MYTDADECVIFGPGLCPNGRCLNTVPGYVCLCNPGFHYDASHKKCEDHDECQDLACEN  1539

Query  1737  GTCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGY  1796
             G C NT GS++C C P   L  +                    RC N   S + L +   
Sbjct  1540  GECVNTEGSFHCFCSPPLTLDLSQQ------------------RCMNSTSSTEDLPDHDI  1581

Query  1797  ELTLDGKNCIDTNECVALPGSCSPGT---CQNLEGSFR--CICPP-GYEVKSESC-IDIN  1849
              + +  K   +      L G  +  T   CQ+ E   +   +CPP   EV ++ C +   
Sbjct  1582  HMDICWKKVTNDVCSEPLRGHRTTYTECCCQDGEAWSQQCALCPPRSSEVYAQLCNVARI  1641

Query  1850  ECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPK-  1908
             E   +  +         PG             D+            F N+   + +VP+ 
Sbjct  1642  EAEREAGVHFRPGYEYGPG------------PDDLHYSIYGPDGAPFYNYLGPEDTVPEP  1689

Query  1909  AFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLE  1968
             AF  T           E    P EL P    VA     P G   +           EC  
Sbjct  1690  AFPNTAGHSADRTPILESPLQPSELQP--HYVASHPEPPAGFEGL--------QAEECGI  1739

Query  1969  SPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDEC-SIGNP---CGNGTCTNVIG  2024
               G C NG C+     + C+C  G+ LD   + C+D +EC  +  P   C +G C N  G
Sbjct  1740  LNG-CENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEG  1798

Query  2025  SFECNCHEGF--EPGP  2038
             S+ C+C  G+  E GP
Sbjct  1799  SYRCHCSPGYVAEAGP  1814


 Score = 238 bits (607),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 254/844 (30%), Positives = 355/844 (42%), Gaps = 124/844 (15%)

Query  1250  LCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICD  1309
             + ENGQ L  P  Y+    +  T       CQDINEC    +C    C N  G + C C 
Sbjct  600   VIENGQ-LECPQGYK---RLNLT------HCQDINECLTLGLCKDAECVNTRGSYLCTCR  649

Query  1310  DGYELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGN  1369
              G  LD +   C         I+ + GLC  + G   C  P   ++  T   C  +RVG 
Sbjct  650   PGLMLDPSRSRCVSDKA----ISMLQGLCYRSLGPGTCTLPLAQRI--TKQICCCSRVGK  703

Query  1370  CY----LKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETC-PPVNSTEYNTLC  1424
              +     K    G  +       G G + +S    L        E   PP    + ++  
Sbjct  704   AWGSECEKCPLPGTEAFREICPAGHGYTYASSDIRLSMRKAEEEELARPPREQGQRSSGA  763

Query  1425  PGGEGFRPNPITIILEDIDECQELP--GLCQGGNCINTFGSFQCEC----------PKGY  1472
               G   R  P+ ++ +   E   +P  G  Q G    +                   +G 
Sbjct  764   LPGPAER-QPLRVVTDTWLEAGTIPDKGDSQAGQVTTSVTHAPAWVTGNATTPPMPEQGI  822

Query  1473  YLSEETRICEDIDECV--AHPG----------VCGPGTCYNTLGNYTCICPPEYMQVNGG  1520
                +E ++    D  V  + PG          VCGPGTC N    Y C+C P Y      
Sbjct  823   AEIQEEQVTPSTDVLVTLSTPGIDRCAAGATNVCGPGTCVNLPDGYRCVCSPGYQLHPSQ  882

Query  1521  HNCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKN  1580
               C D               +NE   +  K    C   VG                    
Sbjct  883   AYCTD---------------DNECLRDPCKGKGRCINRVGSY------------------  909

Query  1581  ICGNIPGFTFDIHSGKA--VDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLV  1638
              C   PG+T           DI+EC E PG+C+ G C N  GS+ CEC  G+     ++V
Sbjct  910   SCFCYPGYTLATSGATQECQDINEC-EQPGVCSGGQCTNTEGSYHCECDQGY-----IMV  963

Query  1639  ----CEDIDECSNGDNLCQRNADCINSPGSYRC-ECAAGFKLSPNGACVDRNECLEIPNV  1693
                 C+DI+EC +       +  C+NSPGSY C  C  G++   +G+CVD NECL  P V
Sbjct  964   RKGHCQDINECRHPGTC--PDGRCVNSPGSYTCLACEEGYR-GQSGSCVDVNECL-TPGV  1019

Query  1694  CSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDEC-ERHPCGNGTCKNTVGSYNC-LCY  1751
             C+HG C +++GS++C C  G++ + D+  C DVDEC  R  C  G C NT GS+ C  C 
Sbjct  1020  CAHGKCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPTGLCLNTEGSFACSACE  1079

Query  1752  PGFELTHN-NDCMDIDECSSFFGQVCRNGRCFNEIGSFKCL-CNEGYELTLDGKNCIDTN  1809
              G+ +  +   C D+DEC+  F  VC +G C N  GSF C  C+ GY  +  G +C D +
Sbjct  1080  NGYWVNEDGTACEDLDECA--FPGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVD  1137

Query  1810  ECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSES-CIDINECNEDPNICLFGSCTNTPG  1868
             EC     SC  G C+N  GS++C+CP G+++ + + C D+NEC  + +    G C N+ G
Sbjct  1138  ECEDPQSSCLGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHGECLNSHG  1197

Query  1869  GFQCICPTGFVLSDNGRRCFDTRQ---------SFCFTNFENGKCSVPKAFNTTKAKCCC  1919
              F C+C  GFV ++ G  C D  +           C     +  C     F  +     C
Sbjct  1198  SFFCLCAPGFVSAEGGTSCQDVDECATTDPCVGGHCVNTEGSFNCLCETGFQPSPESGEC  1257

Query  1920  SKMPG-EGWGDP------CELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGV  1972
               +   E +GDP      CE  P          C  G    P  D    D++EC      
Sbjct  1258  VDIDECEDYGDPVCGTWKCENSPGSYRCVLG--CQPGFHMAPNGDCI--DIDECANDTMC  1313

Query  1973  CSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIG-NPCGNGTCTNVIGSFECNCH  2031
              S+G C NTDGSFRC C  G+ +  +G  C+D +EC +    CG   C NV GSF C C 
Sbjct  1314  GSHGFCDNTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCA  1373

Query  2032  EGFE  2035
                E
Sbjct  1374  SDLE  1377


 Score = 232 bits (591),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 229/769 (30%), Positives = 320/769 (42%), Gaps = 134/769 (17%)

Query  1124  SNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFK  1183
             +N+C  G C N    + C C  GY +      CTD +EC      C     C+N  GS+ 
Sbjct  853   TNVCGPGTCVNLPDGYRCVCSPGYQLHPSQAYCTDDNECL--RDPCKGKGRCINRVGSYS  910

Query  1184  CSCREGWV----GNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTG-DGFTC  1238
             C C  G+     G   +C D++EC      CS   QC N+ GSY C C +G+       C
Sbjct  911   CFCYPGYTLATSGATQECQDINECEQ-PGVCS-GGQCTNTEGSYHCECDQGYIMVRKGHC  968

Query  1239  SDVDECAENVHLCENGQCLNVPGAYRC-ECEMGFTPASDSKSCQDINECSFQNICVFGTC  1297
              D++EC  +   C +G+C+N PG+Y C  CE G+     S SC D+NEC    +C  G C
Sbjct  969   QDINEC-RHPGTCPDGRCVNSPGSYTCLACEEGYR--GQSGSCVDVNECLTPGVCAHGKC  1025

Query  1298  NNLPGMFHCICDDGYELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECN-CPPDFQLN  1356
              NL G F C C+ GYE+      C DVDECA   +C  GLC+NT G + C+ C   + +N
Sbjct  1026  TNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPTGLCLNTEGSFACSACENGYWVN  1085

Query  1357  PTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVN  1416
               G  C D  +  C                    GV  S  C +   ++   C+ C    
Sbjct  1086  EDGTACED--LDECAFP-----------------GVCPSGVCTNTAGSFS--CKDC----  1120

Query  1417  STEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSE  1476
                         G+RP+P+    ED+DEC++    C GG C NT GS+QC CP+G+ L+ 
Sbjct  1121  ----------DGGYRPSPLGDSCEDVDECEDPQSSCLGGECKNTVGSYQCLCPQGFQLAN  1170

Query  1477  ETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRK--------  1528
              T +CED++EC+        G C N+ G++ C+C P ++   GG +C D+ +        
Sbjct  1171  GT-VCEDVNECMGEEHCAPHGECLNSHGSFFCLCAPGFVSAEGGTSCQDVDECATTDPCV  1229

Query  1529  -SFCYRSYNGTSCENELPFNVTKRMCCCT-------YNVGKAWNKPCEPCPTPGTAEFKN  1580
                C  +    +C  E  F  +     C        Y         CE  P      ++ 
Sbjct  1230  GGHCVNTEGSFNCLCETGFQPSPESGECVDIDECEDYGDPVCGTWKCENSP----GSYRC  1285

Query  1581  ICGNIPGFTFDIHSGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYND------  1634
             + G  PGF     +G  +DIDEC       ++G C N  GSFRC C  GF  +       
Sbjct  1286  VLGCQPGFHM-APNGDCIDIDECANDTMCGSHGFCDNTDGSFRCLCDQGFEISPSGWDCV  1344

Query  1635  -------LLLVC-----------------EDIDECSNGDNLCQRNADCINS---------  1661
                    +L VC                  D++E    +  C+       S         
Sbjct  1345  DVNECELMLAVCGAALCENVEGSFLCLCASDLEEYDAQEGHCRPRGAGGQSMSEAPTGDH  1404

Query  1662  -PGSYRCECAAGFK-LSPNGACVDRNECLEI---PNVCSHGLCVDM-----QGSYKCICH  1711
              P   R +C +G K  +P  + + RN            S G   D+        +  IC 
Sbjct  1405  APAPTRMDCYSGQKGHAPCSSVLGRNTTQAECCCTQGASWGDACDLCPSEDSAEFSEICP  1464

Query  1712  NGF-------KASQDQTMCMDVDECERH---PCGNGTCKNTVGSYNCLCYPGFEL-THNN  1760
             +G          +  QTM  D DEC       C NG C NTV  Y CLC PGF     + 
Sbjct  1465  SGKGYIPVEGAWTFGQTMYTDADECVIFGPGLCPNGRCLNTVPGYVCLCNPGFHYDASHK  1524

Query  1761  DCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTN  1809
              C D DEC       C NG C N  GSF C C+    L L  + C+++ 
Sbjct  1525  KCEDHDECQDL---ACENGECVNTEGSFHCFCSPPLTLDLSQQRCMNST  1570


 Score = 211 bits (537),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 179/496 (36%), Positives = 235/496 (47%), Gaps = 68/496 (14%)

Query  1562  AW---NKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKE-IPGICANGVCIN  1617
             AW   N    P P  G AE +     +   T  + +     ID C      +C  G C+N
Sbjct  806   AWVTGNATTPPMPEQGIAEIQE--EQVTPSTDVLVTLSTPGIDRCAAGATNVCGPGTCVN  863

Query  1618  QIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSP  1677
                 +RC C  G+  +     C D +EC    + C+    CIN  GSY C C  G+ L+ 
Sbjct  864   LPDGYRCVCSPGYQLHPSQAYCTDDNECLR--DPCKGKGRCINRVGSYSCFCYPGYTLAT  921

Query  1678  NGA---CVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHP-  1733
             +GA   C D NEC E P VCS G C + +GSY C C  G+   + +  C D++EC RHP 
Sbjct  922   SGATQECQDINEC-EQPGVCSGGQCTNTEGSYHCECDQGYIMVR-KGHCQDINEC-RHPG  978

Query  1734  -CGNGTCKNTVGSYNCL-CYPGFELTHNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCL  1791
              C +G C N+ GSY CL C  G+    +  C+D++EC      VC +G+C N  GSF+C 
Sbjct  979   TCPDGRCVNSPGSYTCLACEEGYR-GQSGSCVDVNEC--LTPGVCAHGKCTNLEGSFRCS  1035

Query  1792  CNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRC-ICPPGYEVKSE--SCIDI  1848
             C +GYE+T D K C D +EC +   SC  G C N EGSF C  C  GY V  +  +C D+
Sbjct  1036  CEQGYEVTSDEKGCQDVDECASR-ASCPTGLCLNTEGSFACSACENGYWVNEDGTACEDL  1094

Query  1849  NECNEDPNICLFGSCTNTPGGFQCI-CPTGFVLSDNGRRCFDTR-----QSFCFTNFENG  1902
             +EC   P +C  G CTNT G F C  C  G+  S  G  C D       QS C      G
Sbjct  1095  DEC-AFPGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECEDPQSSCL----GG  1149

Query  1903  KCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTRED  1962
             +C      NT  +  C              LCP+  ++A   +C              ED
Sbjct  1150  ECK-----NTVGSYQC--------------LCPQGFQLANGTVC--------------ED  1176

Query  1963  VNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGNGTCTNV  2022
             VNEC+       +G C+N+ GSF C C  G+     G  C D DEC+  +PC  G C N 
Sbjct  1177  VNECMGEEHCAPHGECLNSHGSFFCLCAPGFVSAEGGTSCQDVDECATTDPCVGGHCVNT  1236

Query  2023  IGSFECNCHEGFEPGP  2038
              GSF C C  GF+P P
Sbjct  1237  EGSFNCLCETGFQPSP  1252


 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 89/198 (45%), Gaps = 11/198 (6%)

Query  1779  GRCFNEIGSFKCLCNEGYELTLDGKNC--IDTNECVALPGSCSPGTCQNLEGSFRCICPP  1836
             GRC+    + +C  N   ELT     C  +     V L   C P     +  + +  CP 
Sbjct  552   GRCYLNTVNGQC-ANPLLELTTQEDCCGSVGAFWGVTLCAPCPPRPASPVIENGQLECPQ  610

Query  1837  GYE-VKSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTR----  1891
             GY+ +    C DINEC     +C    C NT G + C C  G +L  +  RC   +    
Sbjct  611   GYKRLNLTHCQDINECLTL-GLCKDAECVNTRGSYLCTCRPGLMLDPSRSRCVSDKAISM  669

Query  1892  -QSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGH  1950
              Q  C+ +   G C++P A   TK  CCCS++ G+ WG  CE CP     AF+++CP GH
Sbjct  670   LQGLCYRSLGPGTCTLPLAQRITKQICCCSRV-GKAWGSECEKCPLPGTEAFREICPAGH  728

Query  1951  GTIPGIDDTREDVNECLE  1968
             G      D R  + +  E
Sbjct  729   GYTYASSDIRLSMRKAEE  746


 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 3/76 (4%)

Query  1085  CDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNEC-DLN--SNICMFGECENTKGSFIC  1141
             C+ G+C  +   Y C C++GF        C+DVNEC DLN  + +C+ G CENT+GS+ C
Sbjct  1743  CENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRC  1802

Query  1142  HCQLGYSVKKGTTGCT  1157
             HC  GY  + G   CT
Sbjct  1803  HCSPGYVAEAGPPHCT  1818


 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 49/89 (55%), Gaps = 7/89 (8%)

Query  365   IDIDEC-IQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTN----MCL  419
             +  +EC I NG  C+NGRCV     + C C  GF+L      CVD +EC   N    +C+
Sbjct  1732  LQAEECGILNG--CENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCV  1789

Query  420   NGMCINEDGSFKCICKPGFVLAPNGRYCT  448
             +G C N +GS++C C PG+V      +CT
Sbjct  1790  HGYCENTEGSYRCHCSPGYVAEAGPPHCT  1818


 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 17/137 (12%)

Query  1895  CFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWG----DPCELCPKEEEVAFQDL-CPYG  1949
             C+ N  NG+C+ P    TT+  CC S   G  WG     PC   P    +    L CP G
Sbjct  554   CYLNTVNGQCANPLLELTTQEDCCGSV--GAFWGVTLCAPCPPRPASPVIENGQLECPQG  611

Query  1950  HGTIPGIDDTR-EDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDEC  2008
             +  +   + T  +D+NECL + G+C +  C+NT GS+ C C  G  LD +   C+     
Sbjct  612   YKRL---NLTHCQDINECL-TLGLCKDAECVNTRGSYLCTCRPGLMLDPSRSRCVSDKAI  667

Query  2009  SI-----GNPCGNGTCT  2020
             S+         G GTCT
Sbjct  668   SMLQGLCYRSLGPGTCT  684


> sp|Q9NS15|LTBP3_HUMAN Latent-transforming growth factor beta-binding 
protein 3 OS=Homo sapiens GN=LTBP3 PE=1 SV=4
Length=1303

 Score = 330 bits (845),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 293/1006 (29%), Positives = 430/1006 (43%), Gaps = 137/1006 (14%)

Query  622   GSYSCTCPKGYVFSTETDTCEDINECE-SSPCVNGACRNNLGSFNCECSPGSKLDSTGLI  680
             G     CP+GY     T  C+DINEC     C +G C NN GS+ C C PG  L  +   
Sbjct  335   GEVGADCPQGYKRLNSTH-CQDINECAMPGVCRHGDCLNNPGSYRCVCPPGHSLGPSRTQ  393

Query  681   CIDSL---KGTCW-LNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRGF  736
             CI      K  C+ L   + +C+  +     +  CC ++G AWG+ C+RC  D   +   
Sbjct  394   CIADKPEEKSLCFRLVSPEHQCQHPLTTRLTRQLCCCSVGKAWGARCQRCPTDGTAA---  450

Query  737   ARVNGVTCEDVNECDVFPGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYL  796
                             F  +CP G+  +   S      + LT+ G     L +  +    
Sbjct  451   ----------------FKEICPAGKGYHILTSH-----QTLTIQGESDFSLFLHPDGPPK  489

Query  797   TWDEDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDIL  856
                  E     P     +        +  S+     +             P   +R    
Sbjct  490   PQQLPESPSQAPPPEDTEEERGVTTDSPVSEERSVQQSHPTATTTPARPYPELISRPSPP  549

Query  857   TGRPFYKDI-----------------NECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDM  899
             T R F  D+                 +EC++   +C +G+C      + C CN G+    
Sbjct  550   TMRWFLPDLPPSRSAVEIAPTQVTETDECRLNQNICGHGECVPGPPDYSCHCNPGYRSHP  609

Query  900   EERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMM-KNCMDIDECERNPL  958
             + R C D++EC   P   G G C+NT GS+ C C  GY        ++C+D++EC +  L
Sbjct  610   QHRYCVDVNECEAEPCGPGRGICMNTGGSYNCHCNRGYRLHVGAGGRSCVDLNECAKPHL  669

Query  959   LCRGGTCVNTEGSFQCDCPLGHELSPSREE-CIDVNECSLSDSLCRNGKCVNMVGTYQC-  1016
                GG C+N  G ++C+C  G+ L  SR   C D++EC    S C +GKC N  G+++C 
Sbjct  670   CGDGGFCINFPGHYKCNCYPGYRLKASRPPVCEDIDECR-DPSSCPDGKCENKPGSFKCI  728

Query  1017  SCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADID  1076
             +C  GY++     +C D++EC   +      C N  GS+ C+C+ GYA  PD R+C D+D
Sbjct  729   ACQPGYRSQ-GGGACRDVNECAEGSPCSPGWCENLPGSFRCTCAQGYAPAPDGRSCLDVD  787

Query  1077  ECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTK  1136
             ECE+  D+CD G C+N PG ++C C  G+  S D   C D++ECD  +  C+ G+C NT 
Sbjct  788   ECEAG-DVCDNGICSNTPGSFQCQCLSGYHLSRDRSHCEDIDECDFPA-ACIGGDCINTN  845

Query  1137  GSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIK  1196
             GS+ C C  G+ +  G   C D+DEC      C  H +C N+ GS+ C C EG+     +
Sbjct  846   GSYRCLCPQGHRLVGGRK-CQDIDECSQDPSLCLPHGACKNLQGSYVCVCDEGFTPTQDQ  904

Query  1197  --CIDLDE---------------------CSNGTHQ---CSVNAQC----------VNSP  1220
               C ++++                      +N T Q   CS+ A            V S 
Sbjct  905   HGCEEVEQPHHKKECYLNFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPCPVYSS  964

Query  1221  GSY--LCACVEGFTGDGFTCS-------DVDECAE-NVHLCENGQCLNVPGAYRCECEMG  1270
               +  LC   +G+T D    +       D+DEC      +C+ G+C+N    Y C C+ G
Sbjct  965   AEFHSLCPDGKGYTQDNNIVNYGIPAHRDIDECMLFGSEICKEGKCVNTQPGYECYCKQG  1024

Query  1271  FTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNC-----TDVD  1325
             F    +   C D++EC  ++ C  G C N  G + C C    E       C      DVD
Sbjct  1025  FYYDGNLLECVDVDECLDESNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEEMDVD  1084

Query  1326  ECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGC---------VDNRVGNCYLKYGP  1376
             EC DP  C  G CVN PG Y C C P +   P+G  C            R   C+ +   
Sbjct  1085  ECQDPAACRPGRCVNLPGSYRCECRPPWVPGPSGRDCQLPESPAERAPERRDVCWSQ---  1141

Query  1377  RGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCP--------PVNSTEYNTL---CP  1425
             RG+  +      G  ++   CCC  G+ WG  C  CP        P + +E N+     P
Sbjct  1142  RGEDGMCAGPLAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSHCPTSQSESNSFWDTSP  1201

Query  1426  GGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDID  1485
                G  P       ED DEC+     C  G C+   G   CECP G+ L      C DID
Sbjct  1202  LLLGKPPRDEDSSEEDSDECR-----CVSGRCVPRPGGAVCECPGGFQLDASRARCVDID  1256

Query  1486  EC--VAHPG-VCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRK  1528
             EC  +   G +C    C NT G++ C+C   + +      C+  R+
Sbjct  1257  ECRELNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGACVPQRR  1302


 Score = 294 bits (753),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 318/1135 (28%), Positives = 460/1135 (41%), Gaps = 220/1135 (19%)

Query  5     GPCFTQ-VNNQMCQGQLTGIVCTKTLCCATIGRAWGH-PCEMCPAQPQPCRRGFIPNIRT  62
             G CF   +  Q C       +  +  CC +IG AWG   C  CP                
Sbjct  277   GRCFQDTLPKQPCGSNPLPGLTKQEDCCGSIGTAWGQSKCHKCPQL--------------  322

Query  63    GACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICEG  122
                          GV + G     VG+    CP G+K+  +T  C DI+EC++ PG+C  
Sbjct  323   ----------QYTGVQKPGPVRGEVGA---DCPQGYKRLNSTH-CQDINECAM-PGVCRH  367

Query  123   SECSNTVGSYFCICPRGYVTSTDGSRCI---DQRASTCFSNIV-NGRCAQELPGRFTKRQ  178
              +C N  GSY C+CP G+      ++CI    +  S CF  +    +C   L  R T++ 
Sbjct  368   GDCLNNPGSYRCVCPPGHSLGPSRTQCIADKPEEKSLCFRLVSPEHQCQHPLTTRLTRQL  427

Query  179   CCCESGRCWAMGSVPEMCPVRGSDEYRRLCVDGAPAGGGSR----------GGGTGGNGF  228
             CCC  G+ W  G+  + CP  G+  ++ +C    PAG G             G +  + F
Sbjct  428   CCCSVGKAW--GARCQRCPTDGTAAFKEIC----PAGKGYHILTSHQTLTIQGESDFSLF  481

Query  229   LPSGNGNGHGHGPRGAGFIPIPGSNGFSPGVGGAGVGTGSSTGNGPIITGLTILNQTIDI  288
             L           P      P P       GV      +   +      T  T   +    
Sbjct  482   LHPDGPPKPQQLPESPSQAPPPEDTEEERGVTTDSPVSEERSVQQSHPTATTTPARPYPE  541

Query  289   CKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNGDCTDVDEC--TSNPCSNGDCVNTPGS  346
                 P        +P L   R    +   Q      T+ DEC    N C +G+CV  P  
Sbjct  542   LISRPSPPTMRWFLPDLPPSRSAVEIAPTQ-----VTETDECRLNQNICGHGECVPGPPD  596

Query  347   YYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTT--DGK  404
             Y C C+ G++  P  + C+D++EC         G C+NT GS+ C CN G+ L     G+
Sbjct  597   YSCHCNPGYRSHPQHRYCVDVNECEAEPCGPGRGICMNTGGSYNCHCNRGYRLHVGAGGR  656

Query  405   NCVDHDECTTTNMCLN-GMCINEDGSFKCICKPGFVL-APNGRYCTDIDECQTSGICMNG  462
             +CVD +EC   ++C + G CIN  G +KC C PG+ L A     C DIDEC+    C +G
Sbjct  657   SCVDLNECAKPHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPVCEDIDECRDPSSCPDG  716

Query  463   HCINTEGSFRC-ECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCC  521
              C N  GSF+C  C PG                   Y     GAC          +EC  
Sbjct  717   KCENKPGSFKCIACQPG-------------------YRSQGGGAC-------RDVNEC--  748

Query  522   ANPDYGFGEPCHPCPAKN-SAEFHGLCSSGIGITVDGR---DINECALDPDICSNGICEN  577
                    G PC P   +N    F   C+ G     DGR   D++EC    D+C NGIC N
Sbjct  749   -----AEGSPCSPGWCENLPGSFRCTCAQGYAPAPDGRSCLDVDECEAG-DVCDNGICSN  802

Query  578   LRGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTE  637
               GS++C C SGY       +C DIDEC      C  G C NT GSY C CP+G+     
Sbjct  803   TPGSFQCQCLSGYHLSRDRSHCEDIDECDFP-AACIGGDCINTNGSYRCLCPQGHRL-VG  860

Query  638   TDTCEDINECESSPCV---NGACRNNLGSFNCECSPG--SKLDSTGLICIDS--LKGTCW  690
                C+DI+EC   P +   +GAC+N  GS+ C C  G     D  G   ++    K  C+
Sbjct  861   GRKCQDIDECSQDPSLCLPHGACKNLQGSYVCVCDEGFTPTQDQHGCEEVEQPHHKKECY  920

Query  691   LNIQDSR-CEVNINGATLKSECCATLGAAWGSPCE--------RCELDTACS--RGFARV  739
             LN  D+  C+  +     + ECC +LGA WG  CE          E  + C   +G+ + 
Sbjct  921   LNFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPCPVYSSAEFHSLCPDGKGYTQD  980

Query  740   NGVT------CEDVNECDVF-PGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRME  792
             N +         D++EC +F   +C  G+C+N++  + C C +G   DG    C+D+  +
Sbjct  981   NNIVNYGIPAHRDIDECMLFGSEICKEGKCVNTQPGYECYCKQGFYYDGNLLECVDV--D  1038

Query  793   QCYLTWDEDECIRSV----PGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPG  848
             +C    DE  C   V     G +R   C C   A +     +C  P+             
Sbjct  1039  ECL---DESNCRNGVCENTRGGYR---CACTPPAEYSPAQRQCLSPEE------------  1080

Query  849   FSNRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCT---  905
                            D++EC+  P  C  G+C N  GS++C+C   +      R+C    
Sbjct  1081  --------------MDVDECQ-DPAACRPGRCVNLPGSYRCECRPPWVPGPSGRDCQLPE  1125

Query  906   --------DIDECW-----------------ISPDLC------------------GSGTC  922
                       D CW                 ++ D C                  G+G+ 
Sbjct  1126  SPAERAPERRDVCWSQRGEDGMCAGPLAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSH  1185

Query  923   VNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCR--GGTCVNTEGSFQCDCPLGH  980
               T  S     +D   S  ++ K   D D  E +   CR   G CV   G   C+CP G 
Sbjct  1186  CPTSQSESNSFWD--TSPLLLGKPPRDEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGF  1243

Query  981   ELSPSREECIDVNECSLSDS---LCRNGKCVNMVGTYQCSCNSGYQATPDRRSCT  1032
             +L  SR  C+D++EC   +    LC++ +CVN  G+++C C +G+  +    +C 
Sbjct  1244  QLDASRARCVDIDECRELNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGACV  1298


 Score = 271 bits (693),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 230/749 (31%), Positives = 329/749 (44%), Gaps = 122/749 (16%)

Query  1074  DIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECE  1133
             + DEC  N +IC  G+C   P +Y C C  G+ +    + C+DVNEC+        G C 
Sbjct  574   ETDECRLNQNICGHGECVPGPPDYSCHCNPGYRSHPQHRYCVDVNECEAEPCGPGRGICM  633

Query  1134  NTKGSFICHCQLGYSVKKGTTG--CTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWV  1191
             NT GS+ CHC  GY +  G  G  C D++EC    H C     C+N PG +KC+C  G+ 
Sbjct  634   NTGGSYNCHCNRGYRLHVGAGGRSCVDLNEC-AKPHLCGDGGFCINFPGHYKCNCYPGYR  692

Query  1192  GNGIK---CIDLDECSNGTHQCSVNAQCVNSPGSYLC-ACVEGFTGDGF-TCSDVDECAE  1246
                 +   C D+DEC + +     + +C N PGS+ C AC  G+   G   C DV+ECAE
Sbjct  693   LKASRPPVCEDIDECRDPSS--CPDGKCENKPGSFKCIACQPGYRSQGGGACRDVNECAE  750

Query  1247  NVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHC  1306
                 C  G C N+PG++RC C  G+ PA D +SC D++EC   ++C  G C+N PG F C
Sbjct  751   GS-PCSPGWCENLPGSFRCTCAQGYAPAPDGRSCLDVDECEAGDVCDNGICSNTPGSFQC  809

Query  1307  ICDDGYELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLN----------  1356
              C  GY L R   +C D+DEC  P  C+ G C+NT G Y C CP   +L           
Sbjct  810   QCLSGYHLSRDRSHCEDIDECDFPAACIGGDCINTNGSYRCLCPQGHRLVGGRKCQDIDE  869

Query  1357  ---------PTGV-----------------------GCVD----NRVGNCYLKYGPRGDG  1380
                      P G                        GC +    +    CYL +    D 
Sbjct  870   CSQDPSLCLPHGACKNLQGSYVCVCDEGFTPTQDQHGCEEVEQPHHKKECYLNF----DD  925

Query  1381  SLSCNTEIGVGVSRSSCCCSLGKAWGNPCET--CPPVNSTEYNTLCPGGEGFRPNPITI-  1437
             ++ C++ +   V++  CCCSLG  WG+ CE   CP  +S E+++LCP G+G+  +   + 
Sbjct  926   TVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPCPVYSSAEFHSLCPDGKGYTQDNNIVN  985

Query  1438  ----ILEDIDECQELPG-LCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPG  1492
                    DIDEC      +C+ G C+NT   ++C C +G+Y       C D+DEC+    
Sbjct  986   YGIPAHRDIDECMLFGSEICKEGKCVNTQPGYECYCKQGFYYDGNLLECVDVDECLDE-S  1044

Query  1493  VCGPGTCYNTLGNYTCIC--------------PPEYMQVNGGHNCMDMRKSFCYRSYNGT  1538
              C  G C NT G Y C C               PE M V+   +    R   C       
Sbjct  1045  NCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEEMDVDECQDPAACRPGRCVNLPGSY  1104

Query  1539  SCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNI-------------  1585
              CE   P+        C      A   P          E +++C +              
Sbjct  1105  RCECRPPWVPGPSGRDCQLPESPAERAP----------ERRDVCWSQRGEDGMCAGPLAG  1154

Query  1586  PGFTFDI---HSGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLL--VCE  1640
             P  TFD      G+     +C+  P   A   C     + + E  + +  + LLL     
Sbjct  1155  PALTFDDCCCRQGRGWGA-QCRPCPPRGAGSHCP----TSQSESNSFWDTSPLLLGKPPR  1209

Query  1641  DIDECSNGDNLCQ-RNADCINSPGSYRCECAAGFKLSPNGA-CVDRNECLEIPN---VCS  1695
             D D      + C+  +  C+  PG   CEC  GF+L  + A CVD +EC E+     +C 
Sbjct  1210  DEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGFQLDASRARCVDIDECRELNQRGLLCK  1269

Query  1696  HGLCVDMQGSYKCICHNGFKASQDQTMCM  1724
                CV+  GS++C+C  GF  S+    C+
Sbjct  1270  SERCVNTSGSFRCVCKAGFARSRPHGACV  1298


 Score = 263 bits (673),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 254/801 (32%), Positives = 350/801 (44%), Gaps = 118/801 (15%)

Query  1148  SVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIK--CIDLDECSN  1205
             +V+   T  T+ DEC +  + C  H  CV  P  + C C  G+  +     C+D++EC  
Sbjct  564   AVEIAPTQVTETDECRLNQNICG-HGECVPGPPDYSCHCNPGYRSHPQHRYCVDVNECE-  621

Query  1206  GTHQCSV-NAQCVNSPGSYLCACVEGFT----GDGFTCSDVDECAENVHLC-ENGQCLNV  1259
                 C      C+N+ GSY C C  G+       G +C D++ECA+  HLC + G C+N 
Sbjct  622   -AEPCGPGRGICMNTGGSYNCHCNRGYRLHVGAGGRSCVDLNECAK-PHLCGDGGFCINF  679

Query  1260  PGAYRCECEMGFT-PASDSKSCQDINECSFQNICVFGTCNNLPGMFHCI-CDDGYELDRT  1317
             PG Y+C C  G+   AS    C+DI+EC   + C  G C N PG F CI C  GY   + 
Sbjct  680   PGHYKCNCYPGYRLKASRPPVCEDIDECRDPSSCPDGKCENKPGSFKCIACQPGYR-SQG  738

Query  1318  GGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKYGPR  1377
             GG C DV+ECA+   C  G C N PG + C C   +   P G  C+D  V  C       
Sbjct  739   GGACRDVNECAEGSPCSPGWCENLPGSFRCTCAQGYAPAPDGRSCLD--VDECEA-----  791

Query  1378  GD-----------GSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPG  1426
             GD           GS  C    G  +SR    C                           
Sbjct  792   GDVCDNGICSNTPGSFQCQCLSGYHLSRDRSHC---------------------------  824

Query  1427  GEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDE  1486
                          EDIDEC + P  C GG+CINT GS++C CP+G+ L    R C+DIDE
Sbjct  825   -------------EDIDEC-DFPAACIGGDCINTNGSYRCLCPQGHRLVG-GRKCQDIDE  869

Query  1487  CVAHPGVCGP-GTCYNTLGNYTCICPPEYMQVNGGHNCMDM----RKSFCYRSYNGTS-C  1540
             C   P +C P G C N  G+Y C+C   +      H C ++     K  CY +++ T  C
Sbjct  870   CSQDPSLCLPHGACKNLQGSYVCVCDEGFTPTQDQHGCEEVEQPHHKKECYLNFDDTVFC  929

Query  1541  ENELPFNVTKRMCCCTYNVGKAWNKPCE--PCPTPGTAEFKNICGNIPGFTFD---IHSG  1595
             ++ L  NVT++ CCC+  +G  W   CE  PCP   +AEF ++C +  G+T D   ++ G
Sbjct  930   DSVLATNVTQQECCCS--LGAGWGDHCEIYPCPVYSSAEFHSLCPDGKGYTQDNNIVNYG  987

Query  1596  KAV--DIDECKEIPG-ICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLC  1652
                  DIDEC      IC  G C+N    + C C  GF Y+  LL C D+DEC +  N  
Sbjct  988   IPAHRDIDECMLFGSEICKEGKCVNTQPGYECYCKQGFYYDGNLLECVDVDECLDESNC-  1046

Query  1653  QRNADCINSPGSYRCECAAGFKLSP------NGACVDRNECLEIPNVCSHGLCVDMQGSY  1706
              RN  C N+ G YRC C    + SP      +   +D +EC + P  C  G CV++ GSY
Sbjct  1047  -RNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEEMDVDECQD-PAACRPGRCVNLPGSY  1104

Query  1707  KCICHNGFKASQDQTMC-MDVDECERHPCGNGTCKNTVGSYNCLCYP--GFELTHNNDCM  1763
             +C C   +        C +     ER P     C +  G       P  G  LT ++ C 
Sbjct  1105  RCECRPPWVPGPSGRDCQLPESPAERAPERRDVCWSQRGEDGMCAGPLAGPALTFDDCCC  1164

Query  1764  DIDECSSFFGQVCR-------NGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPG  1816
                     +G  CR          C           +    L        D++E  +   
Sbjct  1165  RQ---GRGWGAQCRPCPPRGAGSHCPTSQSESNSFWDTSPLLLGKPPRDEDSSEEDSDEC  1221

Query  1817  SCSPGTCQNLEGSFRCICPPGYEVKSES--CIDINEC---NEDPNICLFGSCTNTPGGFQ  1871
              C  G C    G   C CP G+++ +    C+DI+EC   N+   +C    C NT G F+
Sbjct  1222  RCVSGRCVPRPGGAVCECPGGFQLDASRARCVDIDECRELNQRGLLCKSERCVNTSGSFR  1281

Query  1872  CICPTGFVLSDNGRRCFDTRQ  1892
             C+C  GF  S     C   R+
Sbjct  1282  CVCKAGFARSRPHGACVPQRR  1302


 Score = 252 bits (643),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 182/494 (37%), Positives = 250/494 (51%), Gaps = 35/494 (7%)

Query  1572  TPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFS  1631
              PG  ++   C   PG+         VD++EC+  P     G+C+N  GS+ C C  G+ 
Sbjct  591   VPGPPDYSCHCN--PGYRSHPQHRYCVDVNECEAEPCGPGRGICMNTGGSYNCHCNRGYR  648

Query  1632  YNDLL--LVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKL--SPNGACVDRNEC  1687
              +       C D++EC+   +LC     CIN PG Y+C C  G++L  S    C D +EC
Sbjct  649   LHVGAGGRSCVDLNECAK-PHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPVCEDIDEC  707

Query  1688  LEIPNVCSHGLCVDMQGSYKCI-CHNGFKASQDQTMCMDVDEC-ERHPCGNGTCKNTVGS  1745
              + P+ C  G C +  GS+KCI C  G++ SQ    C DV+EC E  PC  G C+N  GS
Sbjct  708   RD-PSSCPDGKCENKPGSFKCIACQPGYR-SQGGGACRDVNECAEGSPCSPGWCENLPGS  765

Query  1746  YNCLCYPGFELTHN-NDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKN  1804
             + C C  G+    +   C+D+DEC +  G VC NG C N  GSF+C C  GY L+ D  +
Sbjct  766   FRCTCAQGYAPAPDGRSCLDVDECEA--GDVCDNGICSNTPGSFQCQCLSGYHLSRDRSH  823

Query  1805  CIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYE-VKSESCIDINECNEDPNICL-FGS  1862
             C D +EC   P +C  G C N  GS+RC+CP G+  V    C DI+EC++DP++CL  G+
Sbjct  824   CEDIDEC-DFPAACIGGDCINTNGSYRCLCPQGHRLVGGRKCQDIDECSQDPSLCLPHGA  882

Query  1863  CTNTPGGFQCICPTGFVLSDNGRRCFDTRQSF----CFTNFENGK-CSVPKAFNTTKAKC  1917
             C N  G + C+C  GF  + +   C +  Q      C+ NF++   C    A N T+ +C
Sbjct  883   CKNLQGSYVCVCDEGFTPTQDQHGCEEVEQPHHKKECYLNFDDTVFCDSVLATNVTQQEC  942

Query  1918  CCSKMPGEGWGDPCEL--CPKEEEVAFQDLCPYGHGTIP-------GIDDTREDVNEC-L  1967
             CCS   G GWGD CE+  CP      F  LCP G G          GI   R D++EC L
Sbjct  943   CCSL--GAGWGDHCEIYPCPVYSSAEFHSLCPDGKGYTQDNNIVNYGIPAHR-DIDECML  999

Query  1968  ESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGNGTCTNVIGSFE  2027
                 +C  G C+NT   + C C  G+  D   + C+D DEC   + C NG C N  G + 
Sbjct  1000  FGSEICKEGKCVNTQPGYECYCKQGFYYDGNLLECVDVDECLDESNCRNGVCENTRGGYR  1059

Query  2028  CNCHEGFEPGPMMN  2041
             C C    E  P   
Sbjct  1060  CACTPPAEYSPAQR  1073


 Score = 243 bits (621),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 289/1052 (27%), Positives = 417/1052 (40%), Gaps = 206/1052 (20%)

Query  1093  IPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKG  1152
             + GE    C  G+   ++   C D+NEC +   +C  G+C N  GS+ C C  G+S+   
Sbjct  333   VRGEVGADCPQGYK-RLNSTHCQDINECAM-PGVCRHGDCLNNPGSYRCVCPPGHSLGPS  390

Query  1153  TTGCTDVDECEIGA---------HNCDMHASCVNVPGSFKCSCREGWVGNGIKCIDLDEC  1203
              T C   D+ E  +         H C    +         CS  + W     +C      
Sbjct  391   RTQCI-ADKPEEKSLCFRLVSPEHQCQHPLTTRLTRQLCCCSVGKAWGARCQRCP-----  444

Query  1204  SNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDV----DECAENVHLCENGQCLNV  1259
             ++GT   +    C    G ++    +  T  G +   +    D   +   L E+      
Sbjct  445   TDGT--AAFKEICPAGKGYHILTSHQTLTIQGESDFSLFLHPDGPPKPQQLPESPS--QA  500

Query  1260  PGAYRCECEMGFT---PASDSKSCQDINECS-------FQNICVFGTCNNLPGMFHCICD  1309
             P     E E G T   P S+ +S Q  +  +       +  +    +   +      +  
Sbjct  501   PPPEDTEEERGVTTDSPVSEERSVQQSHPTATTTPARPYPELISRPSPPTMRWFLPDLPP  560

Query  1310  DGYELDRTGGNCTDVDECADPIN-CVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVG  1368
                 ++      T+ DEC    N C +G CV  P  Y C+C P ++ +P    CVD  V 
Sbjct  561   SRSAVEIAPTQVTETDECRLNQNICGHGECVPGPPDYSCHCNPGYRSHPQHRYCVD--VN  618

Query  1369  NCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGE  1428
              C  +  P G G   C    G                              YN  C  G 
Sbjct  619   ECEAE--PCGPGRGICMNTGG-----------------------------SYNCHCNRGY  647

Query  1429  GFRPNPITIILEDIDECQELPGLC-QGGNCINTFGSFQCECPKGYYL-SEETRICEDIDE  1486
                         D++EC + P LC  GG CIN  G ++C C  GY L +    +CEDIDE
Sbjct  648   RLHVGAGGRSCVDLNECAK-PHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPVCEDIDE  706

Query  1487  CVAHPGVCGPGTCYNTLGNYTCI-CPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELP  1545
             C   P  C  G C N  G++ CI C P Y +  GG  C D+ +        G+ C     
Sbjct  707   C-RDPSSCPDGKCENKPGSFKCIACQPGY-RSQGGGACRDVNECA-----EGSPCS----  755

Query  1546  FNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKE  1605
                              W   CE  P      F+  C    G+         +D+DEC E
Sbjct  756   ---------------PGW---CENLP----GSFRCTCAQ--GYAPAPDGRSCLDVDEC-E  790

Query  1606  IPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSY  1665
                +C NG+C N  GSF+C+C +G+  +     CEDIDEC           DCIN+ GSY
Sbjct  791   AGDVCDNGICSNTPGSFQCQCLSGYHLSRDRSHCEDIDECDFPAACI--GGDCINTNGSY  848

Query  1666  RCECAAGFKLSPNGACVDRNECLEIPNVC-SHGLCVDMQGSYKCICHNGFKASQDQTMCM  1724
             RC C  G +L     C D +EC + P++C  HG C ++QGSY C+C  GF  +QDQ  C 
Sbjct  849   RCLCPQGHRLVGGRKCQDIDECSQDPSLCLPHGACKNLQGSYVCVCDEGFTPTQDQHGCE  908

Query  1725  DV-----------------------------------------DECERHPCGNGTCKNTV  1743
             +V                                         D CE +PC       + 
Sbjct  909   EVEQPHHKKECYLNFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPCP----VYSS  964

Query  1744  GSYNCLCYPGFELTHNNDCM--------DIDECSSFFGQVCRNGRCFNEIGSFKCLCNEG  1795
               ++ LC  G   T +N+ +        DIDEC  F  ++C+ G+C N    ++C C +G
Sbjct  965   AEFHSLCPDGKGYTQDNNIVNYGIPAHRDIDECMLFGSEICKEGKCVNTQPGYECYCKQG  1024

Query  1796  YELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVK-------SESCIDI  1848
             +    +   C+D +EC+    +C  G C+N  G +RC C P  E         S   +D+
Sbjct  1025  FYYDGNLLECVDVDECLDE-SNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEEMDV  1083

Query  1849  NECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRC---------FDTRQSFCFTNF  1899
             +EC +DP  C  G C N PG ++C C   +V   +GR C            R+  C++  
Sbjct  1084  DEC-QDPAACRPGRCVNLPGSYRCECRPPWVPGPSGRDCQLPESPAERAPERRDVCWSQR  1142

Query  1900  -ENGKCSVPKAFNT-TKAKCCCSKMPGEGWGDPCELCP-----------KEEEVAFQDLC  1946
              E+G C+ P A    T   CCC +  G GWG  C  CP           + E  +F D  
Sbjct  1143  GEDGMCAGPLAGPALTFDDCCCRQ--GRGWGAQCRPCPPRGAGSHCPTSQSESNSFWDTS  1200

Query  1947  PYGHGTIPGIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTD  2006
             P   G  P  +D+ E+ ++       C +G C+   G   CECP G+ LD +   C+D D
Sbjct  1201  PLLLGKPPRDEDSSEEDSDECR----CVSGRCVPRPGGAVCECPGGFQLDASRARCVDID  1256

Query  2007  EC----SIGNPCGNGTCTNVIGSFECNCHEGF  2034
             EC      G  C +  C N  GSF C C  GF
Sbjct  1257  ECRELNQRGLLCKSERCVNTSGSFRCVCKAGF  1288


 Score = 239 bits (610),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 199/607 (33%), Positives = 266/607 (44%), Gaps = 103/607 (17%)

Query  284   QTIDICKHHPDLCLNGRCIPTLSSYRC-ECNMGYKQDSNGDCTDVDECTS-NPCSNGDCV  341
             + ID C+  P  C +G+C     S++C  C  GY+    G C DV+EC   +PCS G C 
Sbjct  702   EDIDECRD-PSSCPDGKCENKPGSFKCIACQPGYRSQGGGACRDVNECAEGSPCSPGWCE  760

Query  342   NTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTT  401
             N PGS+ C C  G+   P  ++C+D+DEC + G +C NG C NT GSFQC C +G+ L+ 
Sbjct  761   NLPGSFRCTCAQGYAPAPDGRSCLDVDEC-EAGDVCDNGICSNTPGSFQCQCLSGYHLSR  819

Query  402   DGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDIDEC-QTSGICM  460
             D  +C D DEC     C+ G CIN +GS++C+C  G  L   GR C DIDEC Q   +C+
Sbjct  820   DRSHCEDIDECDFPAACIGGDCINTNGSYRCLCPQGHRLV-GGRKCQDIDECSQDPSLCL  878

Query  461   -NGHCINTEGSFRCECPPGLAVGVDGRVCVDT---HMRSTCYGGIKKGA-CVRPFPGAVT  515
              +G C N +GS+ C C  G     D   C +    H +  CY        C       VT
Sbjct  879   PHGACKNLQGSYVCVCDEGFTPTQDQHGCEEVEQPHHKKECYLNFDDTVFCDSVLATNVT  938

Query  516   KSECCCANPDYGFGEPC--HPCPAKNSAEFHGLCSSGIGITVDG----------RDINEC  563
             + ECCC+    G+G+ C  +PCP  +SAEFH LC  G G T D           RDI+EC
Sbjct  939   QQECCCSL-GAGWGDHCEIYPCPVYSSAEFHSLCPDGKGYTQDNNIVNYGIPAHRDIDEC  997

Query  564   AL-DPDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLCRNTPG  622
              L   +IC  G C N +  Y C C  G+  D +   CVD+DEC ++   C NG+C NT G
Sbjct  998   MLFGSEICKEGKCVNTQPGYECYCKQGFYYDGNLLECVDVDEC-LDESNCRNGVCENTRG  1056

Query  623   SYSCTCPKGYVFSTETDTC-----EDINECE-SSPCVNGACRNNLGSFNCECSPGSKLDS  676
              Y C C     +S     C      D++EC+  + C  G C N  GS+ CEC P      
Sbjct  1057  GYRCACTPPAEYSPAQRQCLSPEEMDVDECQDPAACRPGRCVNLPGSYRCECRPPWVPGP  1116

Query  677   TGLIC---------IDSLKGTCWLNI-QDSRCEVNINGATLK-SECCATLGAAWGSPCER  725
             +G  C             +  CW    +D  C   + G  L   +CC   G  WG+ C  
Sbjct  1117  SGRDCQLPESPAERAPERRDVCWSQRGEDGMCAGPLAGPALTFDDCCCRQGRGWGAQCRP  1176

Query  726   CELDTACS------------------------------------------RGFARVNGVT  743
             C    A S                                          R   R  G  
Sbjct  1177  CPPRGAGSHCPTSQSESNSFWDTSPLLLGKPPRDEDSSEEDSDECRCVSGRCVPRPGGAV  1236

Query  744   CE---------------DVNECDVFPG---VCPNGRCINSRGSFHCECPEGLTLDGTGRV  785
             CE               D++EC        +C + RC+N+ GSF C C  G         
Sbjct  1237  CECPGGFQLDASRARCVDIDECRELNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGA  1296

Query  786   CLDIRME  792
             C+  R  
Sbjct  1297  CVPQRRR  1303


 Score = 211 bits (536),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 211/688 (31%), Positives = 293/688 (43%), Gaps = 128/688 (19%)

Query  1392  VSRSSCCCSLGKAWG-NPCETCPPVNST----------EYNTLCPGGEGFRPNPITIILE  1440
               +  CC S+G AWG + C  CP +  T          E    CP G   R N  +   +
Sbjct  298   TKQEDCCGSIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEVGADCPQGYK-RLN--STHCQ  354

Query  1441  DIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCY  1500
             DI+EC  +PG+C+ G+C+N  GS++C CP G+ L           +C+A           
Sbjct  355   DINEC-AMPGVCRHGDCLNNPGSYRCVCPPGHSLGPSR------TQCIAD----------  397

Query  1501  NTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGT-SCENELPFNVTKRMCCCTYNV  1559
                                        KS C+R  +    C++ L   +T+++CCC+  V
Sbjct  398   -----------------------KPEEKSLCFRLVSPEHQCQHPLTTRLTRQLCCCS--V  432

Query  1560  GKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICANGVCI-NQ  1618
             GKAW   C+ CPT GTA FK IC    G+             E      +  +G     Q
Sbjct  433   GKAWGARCQRCPTDGTAAFKEICPAGKGYHILTSHQTLTIQGESDFSLFLHPDGPPKPQQ  492

Query  1619  IGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFK----  1674
             +     + P      +   V  D    S   ++ Q +     +P     E  +       
Sbjct  493   LPESPSQAPPPEDTEEERGVTTD-SPVSEERSVQQSHPTATTTPARPYPELISRPSPPTM  551

Query  1675  ------LSPNGACV--------DRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQ  1720
                   L P+ + V        + +EC    N+C HG CV     Y C C+ G+++    
Sbjct  552   RWFLPDLPPSRSAVEIAPTQVTETDECRLNQNICGHGECVPGPPDYSCHCNPGYRSHPQH  611

Query  1721  TMCMDVDECERHPC--GNGTCKNTVGSYNCLCYPGFEL---THNNDCMDIDECSSFFGQV  1775
               C+DV+ECE  PC  G G C NT GSYNC C  G+ L        C+D++EC+     +
Sbjct  612   RYCVDVNECEAEPCGPGRGICMNTGGSYNCHCNRGYRLHVGAGGRSCVDLNECAK--PHL  669

Query  1776  CRN-GRCFNEIGSFKCLCNEGYELTLDGKN-CIDTNECVALPGSCSPGTCQNLEGSFRCI  1833
             C + G C N  G +KC C  GY L       C D +EC   P SC  G C+N  GSF+CI
Sbjct  670   CGDGGFCINFPGHYKCNCYPGYRLKASRPPVCEDIDECRD-PSSCPDGKCENKPGSFKCI  728

Query  1834  -CPPGYEVK-SESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTR  1891
              C PGY  +   +C D+NEC E  + C  G C N PG F+C C  G+  + +GR C D  
Sbjct  729   ACQPGYRSQGGGACRDVNECAEG-SPCSPGWCENLPGSFRCTCAQGYAPAPDGRSCLDVD  787

Query  1892  QSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHG  1951
             +       +NG                CS  PG                +FQ  C  G+ 
Sbjct  788   ECEAGDVCDNG---------------ICSNTPG----------------SFQCQCLSGYH  816

Query  1952  TIPGIDDTR-EDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSI  2010
                  D +  ED++EC + P  C  G CINT+GS+RC CP G+ L   G  C D DECS 
Sbjct  817   L--SRDRSHCEDIDEC-DFPAACIGGDCINTNGSYRCLCPQGHRL-VGGRKCQDIDECSQ  872

Query  2011  GNP--CGNGTCTNVIGSFECNCHEGFEP  2036
                    +G C N+ GS+ C C EGF P
Sbjct  873   DPSLCLPHGACKNLQGSYVCVCDEGFTP  900


 Score = 193 bits (490),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 267/1031 (26%), Positives = 396/1031 (38%), Gaps = 174/1031 (17%)

Query  303   PTLSSYRCECNMGYKQDSNGDCTDVDECT-SNPCSNGDCVNTPGSYYCKCHAGFQRTPTK  361
             P       +C  GYK+ ++  C D++EC     C +GDC+N PGSY C C  G    P++
Sbjct  332   PVRGEVGADCPQGYKRLNSTHCQDINECAMPGVCRHGDCLNNPGSYRCVCPPGHSLGPSR  391

Query  362   QACIDIDECIQNGVLCKNGRCVNTDGSFQ-----------CICNAGFELTTDGKNCVDHD  410
               C  I +  +   LC   R V+ +   Q           C C+ G       + C    
Sbjct  392   TQC--IADKPEEKSLCF--RLVSPEHQCQHPLTTRLTRQLCCCSVGKAWGARCQRCPTDG  447

Query  411   ECTTTNMCLNGMCINEDGSFKCICKPG-----FVLAPNGR-YCTDIDECQTSGICMNGHC  464
                   +C  G   +   S + +   G       L P+G      + E  +         
Sbjct  448   TAAFKEICPAGKGYHILTSHQTLTIQGESDFSLFLHPDGPPKPQQLPESPSQAPPPE---  504

Query  465   INTEGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANP  524
              +TE            V  D  V  +  ++ +        A  RP+P  +++     + P
Sbjct  505   -DTEEE--------RGVTTDSPVSEERSVQQSHPTATTTPA--RPYPELISRP----SPP  549

Query  525   DYGFGEPCHPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICSNGICENLRGSYRC  584
                +  P  P P++++ E                + +EC L+ +IC +G C      Y C
Sbjct  550   TMRWFLPDLP-PSRSAVEI---------APTQVTETDECRLNQNICGHGECVPGPPDYSC  599

Query  585   NCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTET--DTCE  642
             +CN GY   P  R CVD++EC         G+C NT GSY+C C +GY         +C 
Sbjct  600   HCNPGYRSHPQHRYCVDVNECEAEPCGPGRGICMNTGGSYNCHCNRGYRLHVGAGGRSCV  659

Query  643   DINECESSPCV---NGACRNNLGSFNCECSPGSKLD-STGLICIDSLKGTCWLNIQDSRC  698
             D+NEC + P +    G C N  G + C C PG +L  S   +C D  +     +  D +C
Sbjct  660   DLNEC-AKPHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPVCEDIDECRDPSSCPDGKC  718

Query  699   EVNINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVNGVTCEDVNECDVFPGVCP  758
             E N  G+                   +C    AC  G+    G  C DVNEC      C 
Sbjct  719   E-NKPGSF------------------KC---IACQPGYRSQGGGACRDVNEC-AEGSPCS  755

Query  759   NGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRMDACCC  818
              G C N  GSF C C +G      GR CLD+   +     D   C  + PG F+   C C
Sbjct  756   PGWCENLPGSFRCTCAQGYAPAPDGRSCLDVDECEAGDVCDNGIC-SNTPGSFQ---CQC  811

Query  819   AVGAAWGSDCEECPKPDTKEYEALCPRGPGFSN---------RGDILTGRPFYKDINECK  869
               G     D   C   D  ++ A C  G   +          +G  L G    +DI+EC 
Sbjct  812   LSGYHLSRDRSHCEDIDECDFPAACIGGDCINTNGSYRCLCPQGHRLVGGRKCQDIDECS  871

Query  870   VFPGMCM-NGKCRNTIGSFKCKCNSGFTLDMEERNCTDID------ECWISPD---LCGS  919
               P +C+ +G C+N  GS+ C C+ GFT   ++  C +++      EC+++ D    C S
Sbjct  872   QDPSLCLPHGACKNLQGSYVCVCDEGFTPTQDQHGCEEVEQPHHKKECYLNFDDTVFCDS  931

Query  920   GTCVN--------------------------TPGSFECECFDGYESGFMMMKNCMD----  949
                 N                          +   F   C DG   G+    N ++    
Sbjct  932   VLATNVTQQECCCSLGAGWGDHCEIYPCPVYSSAEFHSLCPDG--KGYTQDNNIVNYGIP  989

Query  950   ----IDECER-NPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRN  1004
                 IDEC      +C+ G CVNT+  ++C C  G     +  EC+DV+EC L +S CRN
Sbjct  990   AHRDIDECMLFGSEICKEGKCVNTQPGYECYCKQGFYYDGNLLECVDVDEC-LDESNCRN  1048

Query  1005  GKCVNMVGTYQCSCNSGYQATPDRRSC-----TDIDECMIMNGGCHTHCTNSEGSYECSC  1059
             G C N  G Y+C+C    + +P +R C      D+DEC          C N  GSY C C
Sbjct  1049  GVCENTRGGYRCACTPPAEYSPAQRQCLSPEEMDVDECQDPAACRPGRCVNLPGSYRCEC  1108

Query  1060  SDGYALMPDVRTC----ADIDECESNPDIC------DGGQCTNIPGEYR----CLCYDGF  1105
                +   P  R C    +  +      D+C      DG     + G       C C  G 
Sbjct  1109  RPPWVPGPSGRDCQLPESPAERAPERRDVCWSQRGEDGMCAGPLAGPALTFDDCCCRQGR  1168

Query  1106  MASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIG  1165
                   + C          + C   + E+          LG   +   +   D DEC   
Sbjct  1169  GWGAQCRPCPPRGA----GSHCPTSQSESNSFWDTSPLLLGKPPRDEDSSEEDSDECRC-  1223

Query  1166  AHNCDMHASCVNVPGSFKCSCREGWV--GNGIKCIDLDECSNGTHQCSV--NAQCVNSPG  1221
                  +   CV  PG   C C  G+    +  +C+D+DEC     +  +  + +CVN+ G
Sbjct  1224  -----VSGRCVPRPGGAVCECPGGFQLDASRARCVDIDECRELNQRGLLCKSERCVNTSG  1278

Query  1222  SYLCACVEGFT  1232
             S+ C C  GF 
Sbjct  1279  SFRCVCKAGFA  1289


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 72/173 (42%), Gaps = 27/173 (16%)

Query  3     RTGPCFTQV-NNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQ-------------  48
             R   C++Q   + MC G L G   T   CC   GR WG  C  CP +             
Sbjct  1134  RRDVCWSQRGEDGMCAGPLAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSHCPTSQSES  1193

Query  49    -----PQPCRRGFIPNIRTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEA  103
                    P   G  P     + +D DEC+     C  G C+   G   C+CP G + + +
Sbjct  1194  NSFWDTSPLLLGKPPRDEDSSEEDSDECR-----CVSGRCVPRPGGAVCECPGGFQLDAS  1248

Query  104   TQKCDDIDECSIIPG---ICEGSECSNTVGSYFCICPRGYVTSTDGSRCIDQR  153
               +C DIDEC  +     +C+   C NT GS+ C+C  G+  S     C+ QR
Sbjct  1249  RARCVDIDECRELNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGACVPQR  1301


> sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 
2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3
Length=2471

 Score = 252 bits (644),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 419/1432 (29%), Positives = 605/1432 (42%), Gaps = 302/1432 (21%)

Query  622   GSYSCTCPKGYVFSTETDTCEDINECESSPCVNG---ACRNNLGSFNCECSPGSKLD---  675
             G+  C CP+G++     + C+  + CE + C NG     +  LG   C C+ G   +   
Sbjct  47    GTGYCKCPEGFL----GEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQ  102

Query  676   -STGLICIDSLK----GTCWLNIQDS---RCEVNINGATLK-SECCATLGAAWGSPCERC  726
              ST   C  S      GTC +  +D+    C+V   G   + ++ C +   A GS C   
Sbjct  103   YSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTV  162

Query  727   --ELDTACSRGFARVNGVTCE-DVNECDVFPGVCPNG-RCINSRGSFHCECPEGLTLDGT  782
               +    C  GF    G  CE DVNECD+ PG C +G  C+N  GS+ C+CP+G     T
Sbjct  163   ANQFSCKCLTGFT---GQKCETDVNECDI-PGHCQHGGTCLNLPGSYQCQCPQGF----T  214

Query  783   GRVCLDIRMEQCYLTWDEDECIR----SVPGKFRMDACCCAVGAAWGSDCE----ECPKP  834
             G+ C     +  Y+      C+        G F  + C C  G   GS CE    +CP  
Sbjct  215   GQYC-----DSLYVPCAPSPCVNGGTCRQTGDFTFE-CNCLPGFE-GSTCERNIDDCPNH  267

Query  835   D----------TKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMN-GKCRNT  883
                           Y   CP            TG+   +D++EC + P  C N G C N 
Sbjct  268   RCQNGGVCVDGVNTYNCRCPPQ---------WTGQFCTEDVDECLLQPNACQNGGTCANR  318

Query  884   IGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMM  943
              G + C C +G++ D    N   ID+C  +    GS TC++   SF C C +G ++G + 
Sbjct  319   NGGYGCVCVNGWSGDDCSEN---IDDCAFASCTPGS-TCIDRVASFSCMCPEG-KAGLL-  372

Query  944   MKNCMDIDECERNPLLCRGGTCVNT---EGSFQCDCPLGHELSPSREECIDVNECSLSDS  1000
                C   D C  NP  C  G   +T    G + C CP G++ +   E   DV+EC++++S
Sbjct  373   ---CHLDDACISNP--CHKGALCDTNPLNGQYICTCPQGYKGADCTE---DVDECAMANS  424

Query  1001  -LCRN-GKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECS  1058
               C + GKCVN  G + C C  GY      R   DI+EC          C +  G + C 
Sbjct  425   NPCEHAGKCVNTDGAFHCECLKGYAGP---RCEMDINECHSDPCQNDATCLDKIGGFTCL  481

Query  1059  CSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMAS----------  1108
             C  G+     V    +I+EC+SNP + + GQC +    ++CLC  GF             
Sbjct  482   CMPGFK---GVHCELEINECQSNPCV-NNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCS  537

Query  1109  ----MDMKTCID---------------------VNECDLNSNICMFGECENTKGSFICHC  1143
                 ++   CID                     ++ CD   + C  G+C++   S+ C C
Sbjct  538   STPCLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCD--PDPCHHGQCQDGIDSYTCIC  595

Query  1144  QLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIKC-IDLDE  1202
               GY    G      +DEC   +  C     C+++   ++C+C+ G   +G+ C I+ D+
Sbjct  596   NPGY---MGAICSDQIDECY--SSPCLNDGRCIDLVNGYQCNCQPG--TSGVNCEINFDD  648

Query  1203  CSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECAENVHLCENGQ-CLNVPG  1261
             C++      ++  C++    Y C C  GFTG      D+DECA N   C  G  C+N   
Sbjct  649   CASNP---CIHGICMDGINRYSCVCSPGFTGQRCNI-DIDECASNP--CRKGATCINGVN  702

Query  1262  AYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNC  1321
              +RC C  G  P   S   Q +NEC   N C+ G C      + C+CD G+     G NC
Sbjct  703   GFRCICPEG--PHHPSCYSQ-VNEC-LSNPCIHGNCTGGLSGYKCLCDAGW----VGINC  754

Query  1322  -TDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGC---VDNRVGNCYLKYGPR  1377
               D +EC        G C N    Y C C   F+    G  C   +D    N  L  G  
Sbjct  755   EVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFK----GYNCQVNIDECASNPCLNQGTC  810

Query  1378  GDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCP----PVNSTEYNTLC-PGGEGFRP  1432
              D          +  +  +C   L     NPCE         N   Y  LC PG +G R 
Sbjct  811   FDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQR-  869

Query  1433  NPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPG  1492
                TI   DIDEC   P +   G C NT GS+ CECP G+   +     EDID+C+A+P 
Sbjct  870   --CTI---DIDECISKPCM-NHGLCHNTQGSYMCECPPGFSGMDCE---EDIDDCLANPC  920

Query  1493  VCGPGTCYNTLGNYTCICPPEYMQ---------------VNGGHNCMDMRKSF---CYRS  1534
               G G+C + +  ++C+C P +                  NGG  C D   S+   C   
Sbjct  921   QNG-GSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGG-TCSDYVNSYTCKCQAG  978

Query  1535  YNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFT--FDI  1592
             ++G  CEN +    T+  C   +N G   +         G   F  +C    GFT  F +
Sbjct  979   FDGVHCENNI-NECTESSC---FNGGTCVD---------GINSFSCLCPV--GFTGSFCL  1023

Query  1593  HSGKAVDIDECKEIPGICAN-GVCINQIGSFRCECPTGF---------------------  1630
             H     +I+EC   P  C N G C++ +G++RC CP G+                     
Sbjct  1024  H-----EINECSSHP--CLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKG  1076

Query  1631  -------------------SYNDLLLVCEDIDECSNG---DNLCQRNADCINSPGSYRCE  1668
                                +Y D+  V  DI     G   ++LCQ +  CIN+  ++ C+
Sbjct  1077  TCVQKKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQ  1136

Query  1669  CAAGFKLSPNGACVDRNECLEIPNVCSHGL-CVDMQGSYKCICHNGFKASQDQTMCMDVD  1727
             C  G+  S     +D  EC   P  C HG  C D  G Y+C C  G++    +    +VD
Sbjct  1137  CPLGYTGSYCEEQLD--ECASNP--CQHGATCSDFIGGYRCECVPGYQGVNCE---YEVD  1189

Query  1728  ECERHPCGN-GTCKNTVGSYNCLCYPGFE--LTHNNDCMDIDECSSFFGQVCRN-GRCFN  1783
             EC+  PC N GTC + V  + C C PG    L   N    ID+C+   G  C N G+C +
Sbjct  1190  ECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEEN----IDDCAR--GPHCLNGGQCMD  1243

Query  1784  EIGSFKCLCNEGYELTLDGKNCI-DTNECVALPGSCSPGT--CQNLEGSFRCICPPGYEV  1840
              IG + C C  G+     G+ C  D NEC++ P S S G+  C  L   + C+C   +  
Sbjct  1244  RIGGYSCRCLPGFA----GERCEGDINECLSNPCS-SEGSLDCIQLTNDYLCVCRSAFTG  1298

Query  1841  KS-ESCIDINECNEDPNICLFGS----CTNTPGGFQCICPTGFVLSDNGRRC  1887
             +  E+ +D+  C + P  CL G      +N P GF C CP GF    +G RC
Sbjct  1299  RHCETFVDV--CPQMP--CLNGGTCAVASNMPDGFICRCPPGF----SGARC  1342


 Score = 250 bits (639),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 451/1574 (29%), Positives = 631/1574 (40%), Gaps = 372/1574 (24%)

Query  324   CTDVDECTSNPCSN-GDCVNTP--GSYYCKCHAGFQ----RTPTKQACIDIDECIQNGVL  376
             C   D C  N C N G CV     G   C+C +GF     +  T   C     C+  G  
Sbjct  62    CQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTC  121

Query  377   CKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNG-MCINEDGSFKCICK  435
                 R      +++C C  GF     GK C   D C  ++ C NG  C      F C C 
Sbjct  122   HMLSR-----DTYECTCQVGFT----GKECQWTDAC-LSHPCANGSTCTTVANQFSCKCL  171

Query  436   PGFVLAPNGRYC-TDIDECQTSGICMN-GHCINTEGSFRCECPPGLAVGVDGRVCVDTHM  493
              GF     G+ C TD++EC   G C + G C+N  GS++C+CP G      G+ C   ++
Sbjct  172   TGFT----GQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFT----GQYCDSLYV  223

Query  494   RSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGF-GEPCH----PCPAKNSAEFHGLCS  548
                    +  G C +   G  T  EC C     GF G  C      CP  +  +  G+C 
Sbjct  224   PCAPSPCVNGGTCRQ--TGDFT-FECNCLP---GFEGSTCERNIDDCP-NHRCQNGGVCV  276

Query  549   SGIGITVDGR------------DINECALDPDICSN-GICENLRGSYRCNCNSGYEPDPS  595
              G+  T + R            D++EC L P+ C N G C N  G Y C C +G+  D  
Sbjct  277   DGVN-TYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDC  335

Query  596   GRNCVD------------IDECSVNRLLCDNG---------------------LCRNTP-  621
               N  D            ID  +    +C  G                     LC   P 
Sbjct  336   SENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPL  395

Query  622   -GSYSCTCPKGYVFSTETDTCEDINECE---SSPCVN-GACRNNLGSFNCECSPGSKLDS  676
              G Y CTCP+GY      D  ED++EC    S+PC + G C N  G+F+CEC        
Sbjct  396   NGQYICTCPQGY---KGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCEC--------  444

Query  677   TGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCAT----LGAAWGSPCERCELDTAC  732
                     LKG         RCE++IN     S+ C      L    G  C        C
Sbjct  445   --------LKG-----YAGPRCEMDIN--ECHSDPCQNDATCLDKIGGFTC-------LC  482

Query  733   SRGFARVNGVTCE-DVNECDVFPGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRM  791
               GF    GV CE ++NEC   P V  NG+C++    F C CP G     TG VC  I +
Sbjct  483   MPGF---KGVHCELEINECQSNPCV-NNGQCVDKVNRFQCLCPPGF----TGPVC-QIDI  533

Query  792   EQCYLTWDEDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSN  851
             + C  T     C+                    G+ C + P      YE  C  G     
Sbjct  534   DDCSST----PCLN-------------------GAKCIDHP----NGYECQCATG-----  561

Query  852   RGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTD-IDEC  910
                  TG    ++I+ C   P  C +G+C++ I S+ C CN G+   +    C+D IDEC
Sbjct  562   ----FTGVLCEENIDNCD--PDPCHHGQCQDGIDSYTCICNPGYMGAI----CSDQIDEC  611

Query  911   WISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNC-MDIDECERNPLLCRGGTCVNTE  969
             + SP L   G C++    ++C C  G  SG     NC ++ D+C  NP  C  G C++  
Sbjct  612   YSSPCL-NDGRCIDLVNGYQCNCQPG-TSGV----NCEINFDDCASNP--CIHGICMDGI  663

Query  970   GSFQCDCPLGHELSPSREEC-IDVNECSLSDSLCRNGK-CVNMVGTYQCSCNSGYQATPD  1027
               + C C  G     + + C ID++EC  + + CR G  C+N V  ++C C  G    P 
Sbjct  664   NRYSCVCSPGF----TGQRCNIDIDEC--ASNPCRKGATCINGVNGFRCICPEG----PH  713

Query  1028  RRSC-TDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICD  1086
               SC + ++EC+  N   H +CT     Y+C C  G+     +    D +EC SNP   +
Sbjct  714   HPSCYSQVNECL-SNPCIHGNCTGGLSGYKCLCDAGWV---GINCEVDKNECLSNP-CQN  768

Query  1087  GGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICM-FGECENTKGSFICHCQL  1145
             GG C N+   YRC C  GF         ++++EC   SN C+  G C +    + CHC L
Sbjct  769   GGTCDNLVNGYRCTCKKGFKG---YNCQVNIDEC--ASNPCLNQGTCFDDISGYTCHCVL  823

Query  1146  GYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPG--SFKCSCREGWVGNGIKC-IDLDE  1202
              Y+ K   T            + C+  A C   P   S+ C C  GW G   +C ID+DE
Sbjct  824   PYTGKNCQTVLA-----PCSPNPCENAAVCKESPNFESYTCLCAPGWQGQ--RCTIDIDE  876

Query  1203  CSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTC-SDVDECAENVHLCEN-GQCLNVP  1260
             C   +  C  +  C N+ GSY+C C  GF+  G  C  D+D+C  N   C+N G C++  
Sbjct  877   CI--SKPCMNHGLCHNTQGSYMCECPPGFS--GMDCEEDIDDCLANP--CQNGGSCMDGV  930

Query  1261  GAYRCECEMGFTPASDSKSCQ-DINECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGG  1319
               + C C  GFT       CQ D+NEC  +     GTC++    + C C  G++    G 
Sbjct  931   NTFSCLCLPGFT----GDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFD----GV  982

Query  1320  NC-TDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCY----LKY  1374
             +C  +++EC +      G CV+    + C CP  F    TG  C+ + +  C     L  
Sbjct  983   HCENNINECTESSCFNGGTCVDGINSFSCLCPVGF----TGSFCL-HEINECSSHPCLNE  1037

Query  1375  GPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCE---TCPPVNSTEYNTLCPGGEGFR  1431
             G   DG  +      +G +  +C   +     +PC+   TC      E   LCP G    
Sbjct  1038  GTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTC-VQKKAESQCLCPSGWAGA  1096

Query  1432  PNPITIILEDIDECQE---LPGLCQ-GGNCINTFGSFQCECPKGYYLSEETRICED-IDE  1486
                +  +  DI   +    +  LCQ  G CIN   +  C+CP GY  S     CE+ +DE
Sbjct  1097  YCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLGYTGS----YCEEQLDE  1152

Query  1487  CVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPF  1546
             C ++P   G  TC + +G Y C C P Y  VN                            
Sbjct  1153  CASNPCQHG-ATCSDFIGGYRCECVPGYQGVN----------------------------  1183

Query  1547  NVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEI  1606
                     C Y V +  N+PC+                        + G  +D+      
Sbjct  1184  --------CEYEVDECQNQPCQ------------------------NGGTCIDL------  1205

Query  1607  PGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYR  1666
                         +  F+C CP G      LL  E+ID+C+ G + C     C++  G Y 
Sbjct  1206  ------------VNHFKCSCPPGTRG---LLCEENIDDCARGPH-CLNGGQCMDRIGGYS  1249

Query  1667  CECAAGFKLSPNGACV-DRNECLEIPNVCSHGL-CVDMQGSYKCICHNGFKASQDQTMCM  1724
             C C  GF       C  D NECL  P      L C+ +   Y C+C + F     +T   
Sbjct  1250  CRCLPGFA---GERCEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETF--  1304

Query  1725  DVDECERHPCGNG----TCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSFFGQV-CRNG  1779
              VD C + PC NG       N    + C C PGF             C S  GQV CR G
Sbjct  1305  -VDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFSGA---------RCQSSCGQVKCRKG  1354

Query  1780  -RCFNEIGSFKCLC  1792
              +C +     +C C
Sbjct  1355  EQCVHTASGPRCFC  1368


 Score = 236 bits (603),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 387/1386 (28%), Positives = 573/1386 (41%), Gaps = 265/1386 (19%)

Query  559   DINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLCR  618
             D+NEC +       G C NL GSY+C C  G+    +G+ C  +          + G CR
Sbjct  182   DVNECDIPGHCQHGGTCLNLPGSYQCQCPQGF----TGQYCDSLYVPCAPSPCVNGGTCR  237

Query  619   NTPG-SYSCTCPKGYVFSTETDTCE-DINECESSPCVN-GACRNNLGSFNCECSPGSKLD  675
              T   ++ C C  G+    E  TCE +I++C +  C N G C + + ++NC C P     
Sbjct  238   QTGDFTFECNCLPGF----EGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPP----Q  289

Query  676   STGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRG  735
              TG  C + +   C L  Q + C+   NG T     CA     +G  C        CS  
Sbjct  290   WTGQFCTEDVD-ECLL--QPNACQ---NGGT-----CANRNGGYGCVCVNGWSGDDCS--  336

Query  736   FARVNGVTCEDVNECDVFPGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCY  795
                      E++++C  F    P   CI+   SF C CPEG      G +C         
Sbjct  337   ---------ENIDDC-AFASCTPGSTCIDRVASFSCMCPEG----KAGLLC---------  373

Query  796   LTWDEDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDI  855
                              +D  C +     G+ C+    P   +Y   CP+G         
Sbjct  374   ----------------HLDDACISNPCHKGALCDT--NPLNGQYICTCPQG---------  406

Query  856   LTGRPFYKDINECKVF-PGMCMN-GKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWIS  913
               G    +D++EC +     C + GKC NT G+F C+C  G+     E    DI+EC   
Sbjct  407   YKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCE---MDINECHSD  463

Query  914   PDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQ  973
             P      TC++  G F C C      GF  +   ++I+EC+ NP +   G CV+    FQ
Sbjct  464   P-CQNDATCLDKIGGFTCLCM----PGFKGVHCELEINECQSNPCV-NNGQCVDKVNRFQ  517

Query  974   CDCPLGHELSPSREECIDVNECSLSDSLCRNG-KCVNMVGTYQCSCNSGYQAT--PDRRS  1030
             C CP G      +   ID+++C  S + C NG KC++    Y+C C +G+      +   
Sbjct  518   CLCPPGFTGPVCQ---IDIDDC--SSTPCLNGAKCIDHPNGYECQCATGFTGVLCEENID  572

Query  1031  CTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCAD-IDECESNPDICDGGQ  1089
               D D C       H  C +   SY C C+ GY        C+D IDEC S+P + D G+
Sbjct  573   NCDPDPCH------HGQCQDGIDSYTCICNPGYM----GAICSDQIDECYSSPCLND-GR  621

Query  1090  CTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSV  1149
             C ++   Y+C C  G           ++N  D  SN C+ G C +    + C C  G++ 
Sbjct  622   CIDLVNGYQCNCQPGTSG-----VNCEINFDDCASNPCIHGICMDGINRYSCVCSPGFTG  676

Query  1150  KKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCRE---------------------  1188
             ++      D+DEC   ++ C   A+C+N    F+C C E                     
Sbjct  677   QRCN---IDIDEC--ASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQVNECLSNPCIH  731

Query  1189  ----------------GWVGNGIKC-IDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGF  1231
                             GWV  GI C +D +EC   ++ C     C N    Y C C +GF
Sbjct  732   GNCTGGLSGYKCLCDAGWV--GINCEVDKNECL--SNPCQNGGTCDNLVNGYRCTCKKGF  787

Query  1232  TGDGFTCS-DVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQN  1290
                G+ C  ++DECA N  L   G C +    Y C C + +T     K+CQ +      N
Sbjct  788   K--GYNCQVNIDECASNPCL-NQGTCFDDISGYTCHCVLPYT----GKNCQTVLAPCSPN  840

Query  1291  ICV-FGTCNNLPGM--FHCICDDGYELDRTGGNCT-DVDECADPINCVNGLCVNTPGRYE  1346
              C     C   P    + C+C  G++    G  CT D+DEC       +GLC NT G Y 
Sbjct  841   PCENAAVCKESPNFESYTCLCAPGWQ----GQRCTIDIDECISKPCMNHGLCHNTQGSYM  896

Query  1347  CNCPPDFQLNPTGVGC---VDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGK  1403
             C CPP F    +G+ C   +D+ + N     G   DG  + +     G +   C   + +
Sbjct  897   CECPPGF----SGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNE  952

Query  1404  AWGNPCETCPPVNSTEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGS  1463
                 PC+     +    +  C    GF          +I+EC E      GG C++   S
Sbjct  953   CLSEPCKNGGTCSDYVNSYTCKCQAGFDG---VHCENNINECTESSCF-NGGTCVDGINS  1008

Query  1464  FQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNC  1523
             F C CP G+  S       +I+EC +HP +   GTC + LG Y C CP  Y     G NC
Sbjct  1009  FSCLCPVGFTGS---FCLHEINECSSHPCL-NEGTCVDGLGTYRCSCPLGYT----GKNC  1060

Query  1524  MDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICG  1583
               +  + C RS     C+N       K  C     V K     C  CP+     +     
Sbjct  1061  QTL-VNLCSRS----PCKN-------KGTC-----VQKKAESQCL-CPSGWAGAY----C  1098

Query  1584  NIPGFTFDIHSGKAVDIDECKEIPGICAN-GVCINQIGSFRCECPTGF--SYNDLLLVCE  1640
             ++P  + DI + +   + E      +C + GVCIN   +  C+CP G+  SY +     E
Sbjct  1099  DVPNVSCDIAASRRGVLVE-----HLCQHSGVCINAGNTHYCQCPLGYTGSYCE-----E  1148

Query  1641  DIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSH-GLC  1699
              +DEC++  N CQ  A C +  G YRCEC  G++       VD  EC   P  C + G C
Sbjct  1149  QLDECAS--NPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVD--ECQNQP--CQNGGTC  1202

Query  1700  VDMQGSYKCICHNGFKASQDQTMCMD-VDECERHP--CGNGTCKNTVGSYNCLCYPGFEL  1756
             +D+   +KC C  G +      +C + +D+C R P     G C + +G Y+C C PGF  
Sbjct  1203  IDLVNHFKCSCPPGTRG----LLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAG  1258

Query  1757  THNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNC-IDTNECVALP  1815
                    DI+EC S       +  C      + C+C   +     G++C    + C  +P
Sbjct  1259  ERCEG--DINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFT----GRHCETFVDVCPQMP  1312

Query  1816  ----GSCSPGTCQNLEGSFRCICPPGYE-VKSESCIDINECNEDPNICLFGSCTNTPGGF  1870
                 G+C+     N+   F C CPPG+   + +S     +C +         C +T  G 
Sbjct  1313  CLNGGTCA--VASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQ------CVHTASGP  1364

Query  1871  QCICPT  1876
             +C CP+
Sbjct  1365  RCFCPS  1370


 Score = 232 bits (592),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 369/1267 (29%), Positives = 527/1267 (42%), Gaps = 232/1267 (18%)

Query  875   CMNGKCRNTIG--SFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECE  932
             C+NG   + +   +++C C  GFT     + C   D C   P   GS TC      F C+
Sbjct  115   CLNGGTCHMLSRDTYECTCQVGFT----GKECQWTDACLSHPCANGS-TCTTVANQFSCK  169

Query  933   CFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDV  992
             C     +GF   K   D++EC+       GGTC+N  GS+QC CP G     + + C D 
Sbjct  170   CL----TGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGF----TGQYC-DS  220

Query  993   NECSLSDSLCRNGKCVNMVG--TYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTN  1050
                  + S C NG      G  T++C+C  G++ +   R+  D       NGG    C +
Sbjct  221   LYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGV---CVD  277

Query  1051  SEGSYECSCSDGYALMPDVRTCADIDECESNPDIC-DGGQCTNIPGEYRCLCYDG-----  1104
                +Y C C   +          D+DEC   P+ C +GG C N  G Y C+C +G     
Sbjct  278   GVNTYNCRCPPQWT---GQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDD  334

Query  1105  ---------FMASMDMKTCIDVNE--------------CDLN----SNICMFGECENT--  1135
                      F +     TCID                 C L+    SN C  G   +T  
Sbjct  335   CSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNP  394

Query  1136  -KGSFICHCQLGYSVKKGTTGCTDVDECEIGAHN-CDMHASCVNVPGSFKCSCREGWVGN  1193
               G +IC C  GY   KG     DVDEC +   N C+    CVN  G+F C C +G+ G 
Sbjct  395   LNGQYICTCPQGY---KGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGP  451

Query  1194  GIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCS-DVDECAENVHLCE  1252
               + +D++EC   +  C  +A C++  G + C C+ GF   G  C  +++EC  N  +  
Sbjct  452   RCE-MDINECH--SDPCQNDATCLDKIGGFTCLCMPGFK--GVHCELEINECQSNPCV-N  505

Query  1253  NGQCLNVPGAYRCECEMGFTPASDSKSCQ-DINECSFQNICVFGTCNNLPGMFHCICDDG  1311
             NGQC++    ++C C  GFT       CQ DI++CS         C + P  + C C  G
Sbjct  506   NGQCVDKVNRFQCLCPPGFT----GPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATG  561

Query  1312  YELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCY  1371
             +    TG  C +  +  DP  C +G C +    Y C C P +     G  C D ++  CY
Sbjct  562   F----TGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM----GAICSD-QIDECY  612

Query  1372  ----LKYGPRGD--GSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNST-EYNTLC  1424
                 L  G   D      CN +   G S  +C  +      NPC     ++    Y+ +C
Sbjct  613   SSPCLNDGRCIDLVNGYQCNCQ--PGTSGVNCEINFDDCASNPCIHGICMDGINRYSCVC  670

Query  1425  -PGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICED  1483
              PG  G R N       DIDEC   P   +G  CIN    F+C CP+G +          
Sbjct  671   SPGFTGQRCN------IDIDECASNPCR-KGATCINGVNGFRCICPEGPH---HPSCYSQ  720

Query  1484  IDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQV---------------NGG--HNCMDM  1526
             ++EC+++P  C  G C   L  Y C+C   ++ +               NGG   N ++ 
Sbjct  721   VNECLSNP--CIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNG  778

Query  1527  RKSFCYRSYNGTSCENELPF--------------NVTKRMCCCTY-NVGKAWNKPCEPCP  1571
              +  C + + G +C+  +                +++   C C     GK       PC 
Sbjct  779   YRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPC-  837

Query  1572  TPGTAEFKNICGNIPGFTFDI------HSGK--AVDIDECKEIPGICAN-GVCINQIGSF  1622
             +P   E   +C   P F            G+   +DIDEC   P  C N G+C N  GS+
Sbjct  838   SPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKP--CMNHGLCHNTQGSY  895

Query  1623  RCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACV  1682
              CECP GFS  D     EDID+C    N CQ    C++   ++ C C  GF  + +    
Sbjct  896   MCECPPGFSGMDCE---EDIDDCLA--NPCQNGGSCMDGVNTFSCLCLPGF--TGDKCQT  948

Query  1683  DRNECLEIPNVCSH-GLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPCGN-GTCK  1740
             D NECL  P  C + G C D   SY C C  GF     +    +++EC    C N GTC 
Sbjct  949   DMNECLSEP--CKNGGTCSDYVNSYTCKCQAGFDGVHCEN---NINECTESSCFNGGTCV  1003

Query  1741  NTVGSYNCLCYPGFELTHNNDCMDIDECSSFFGQVCRN-GRCFNEIGSFKCLCNEGYELT  1799
             + + S++CLC  GF  T +    +I+ECSS     C N G C + +G+++C C  GY   
Sbjct  1004  DGINSFSCLCPVGF--TGSFCLHEINECSS---HPCLNEGTCVDGLGTYRCSCPLGYT--  1056

Query  1800  LDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGY-----EVKSESCIDINECNED  1854
               GKNC       +     + GTC   +   +C+CP G+     +V + SC DI      
Sbjct  1057  --GKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAGAYCDVPNVSC-DIAASRRG  1113

Query  1855  ---PNICLF-GSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAF  1910
                 ++C   G C N      C CP G+              S+C    +  +C    A 
Sbjct  1114  VLVEHLCQHSGVCINAGNTHYCQCPLGYT------------GSYCEEQLD--EC----AS  1155

Query  1911  NTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESP  1970
             N  +    CS   G   G  CE  P  + V     C Y             +V+EC   P
Sbjct  1156  NPCQHGATCSDFIG---GYRCECVPGYQGVN----CEY-------------EVDECQNQP  1195

Query  1971  GVCSN-GHCINTDGSFRCECPMGYNLDYTGVHCID-TDECSIGNPCGN-GTCTNVIGSFE  2027
               C N G CI+    F+C CP G      G+ C +  D+C+ G  C N G C + IG + 
Sbjct  1196  --CQNGGTCIDLVNHFKCSCPPGTR----GLLCEENIDDCARGPHCLNGGQCMDRIGGYS  1249

Query  2028  CNCHEGF  2034
             C C  GF
Sbjct  1250  CRCLPGF  1256


 Score = 224 bits (570),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 317/1105 (29%), Positives = 480/1105 (43%), Gaps = 172/1105 (16%)

Query  301   CIPTLSSYRCECNMGYKQDSNGDCTDVDECTSNPCSNGDCVNTP---GSYYCKCHAGFQR  357
             CI  ++S+ C C  G    +   C   D C SNPC  G   +T    G Y C C  G++ 
Sbjct  353   CIDRVASFSCMCPEG---KAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKG  409

Query  358   TPTKQACIDIDEC-IQNGVLCKN-GRCVNTDGSFQCICNAGFELTTDGKNC-VDHDECTT  414
                 +   D+DEC + N   C++ G+CVNTDG+F C C  G+     G  C +D +EC +
Sbjct  410   ADCTE---DVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYA----GPRCEMDINECHS  462

Query  415   TNMCLNGMCINEDGSFKCICKPGFVLAPNGRYC-TDIDECQTSGICMNGHCINTEGSFRC  473
                  +  C+++ G F C+C PGF     G +C  +I+ECQ++    NG C++    F+C
Sbjct  463   DPCQNDATCLDKIGGFTCLCMPGF----KGVHCELEINECQSNPCVNNGQCVDKVNRFQC  518

Query  474   ECPPGLAVGVDGRVCVDTHMRSTCYGGIK--------KGACVRPFPGAVTKSECCCANPD  525
              CPPG   G   ++ +D    + C  G K        +  C   F G + +      +PD
Sbjct  519   LCPPGF-TGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPD  577

Query  526   YGFGEPCHPCPAKNSAEFHG-LCSSGIGITVDGRDINECALDPDICSNGICENLRGSYRC  584
                  PCH    ++  + +  +C+ G    +    I+EC   P + ++G C +L   Y+C
Sbjct  578   -----PCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCL-NDGRCIDLVNGYQC  631

Query  585   NCNSGYEPDPSGRNC-VDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCED  643
             NC    +P  SG NC ++ D+C+ N   C +G+C +    YSC C  G+   T      D
Sbjct  632   NC----QPGTSGVNCEINFDDCASNP--CIHGICMDGINRYSCVCSPGF---TGQRCNID  682

Query  644   INECESSPCVNGA-CRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVNI  702
             I+EC S+PC  GA C N +  F C C  G    S            C+  + +      I
Sbjct  683   IDECASNPCRKGATCINGVNGFRCICPEGPHHPS------------CYSQVNECLSNPCI  730

Query  703   NGATLKSECCATLGAAWGSPCERCELDTACSRGFARVNGVTCE-DVNECDVFPGVCPN-G  760
             +G           G   G  C        C  G+    G+ CE D NEC   P  C N G
Sbjct  731   HG--------NCTGGLSGYKC-------LCDAGWV---GINCEVDKNECLSNP--CQNGG  770

Query  761   RCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLT--WDEDECIRSVPGKFRMDACCC  818
              C N    + C C +G      G  C  + +++C      ++  C   + G       C 
Sbjct  771   TCDNLVNGYRCTCKKGF----KGYNC-QVNIDECASNPCLNQGTCFDDISGYT-----CH  820

Query  819   AVGAAWGSDCEECP---KPDTKEYEALCPRGPGFSNRGDI----LTGRPFYKDINECKVF  871
              V    G +C+       P+  E  A+C   P F +   +      G+    DI+EC   
Sbjct  821   CVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISK  880

Query  872   PGMCMN-GKCRNTIGSFKCKCNSGFT-LDMEERNCTDIDECWISPDLCGSGTCVNTPGSF  929
             P  CMN G C NT GS+ C+C  GF+ +D EE    DID+C  +P   G G+C++   +F
Sbjct  881   P--CMNHGLCHNTQGSYMCECPPGFSGMDCEE----DIDDCLANPCQNG-GSCMDGVNTF  933

Query  930   ECECFDGYESGFMMMKNCMDIDECERNPLLCR-GGTCVNTEGSFQCDCPLGHELSPSREE  988
              C C      GF   K   D++EC   P  C+ GGTC +   S+ C C  G +       
Sbjct  934   SCLCL----PGFTGDKCQTDMNECLSEP--CKNGGTCSDYVNSYTCKCQAGFDGVHCEN-  986

Query  989   CIDVNECSLSDSLCRN-GKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTH  1047
               ++NEC  ++S C N G CV+ + ++ C C  G+  +       +I+EC          
Sbjct  987   --NINEC--TESSCFNGGTCVDGINSFSCLCPVGFTGS---FCLHEINECSSHPCLNEGT  1039

Query  1048  CTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMA  1107
             C +  G+Y CSC  GY      + C  +    S     + G C     E +CLC  G+  
Sbjct  1040  CVDGLGTYRCSCPLGYT----GKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAG  1095

Query  1108  SM-DMKTCIDVNECDLNS--------NICMF-GECENTKGSFICHCQLGYSVKKGTTGCT  1157
             +  D+        CD+ +        ++C   G C N   +  C C LGY+   G+    
Sbjct  1096  AYCDVPNV----SCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLGYT---GSYCEE  1148

Query  1158  DVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIKC-IDLDECSNGTHQCSVNAQC  1216
              +DEC   ++ C   A+C +  G ++C C  G+   G+ C  ++DEC N    C     C
Sbjct  1149  QLDEC--ASNPCQHGATCSDFIGGYRCECVPGY--QGVNCEYEVDECQN--QPCQNGGTC  1202

Query  1217  VNSPGSYLCACVEGFTGDGFTCSD-VDECAENVHLCENGQCLNVPGAYRCECEMGFTPAS  1275
             ++    + C+C  G    G  C + +D+CA   H    GQC++  G Y C C  GF    
Sbjct  1203  IDLVNHFKCSCPPGTR--GLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFA---  1257

Query  1276  DSKSCQ-DINECSFQNICVFGT--CNNLPGMFHCICDDGYELDRTGGNCTDVDECADPIN  1332
               + C+ DINEC        G+  C  L   + C+C   +    TG +C    +    + 
Sbjct  1258  -GERCEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAF----TGRHCETFVDVCPQMP  1312

Query  1333  CVNG----LCVNTPGRYECNCPPDF  1353
             C+NG    +  N P  + C CPP F
Sbjct  1313  CLNGGTCAVASNMPDGFICRCPPGF  1337


 Score = 201 bits (510),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 364/1333 (27%), Positives = 540/1333 (41%), Gaps = 266/1333 (20%)

Query  296   CLNGRCIPTLS--SYRCECNMGYKQDSNGDCTDVDECTSNPCSNGD-CVNTPGSYYCKCH  352
             CLNG     LS  +Y C C +G+   +  +C   D C S+PC+NG  C      + CKC 
Sbjct  115   CLNGGTCHMLSRDTYECTCQVGF---TGKECQWTDACLSHPCANGSTCTTVANQFSCKCL  171

Query  353   AGFQRTPTKQAC-IDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDE  411
              GF    T Q C  D++EC   G     G C+N  GS+QC C  GF     G+ C     
Sbjct  172   TGF----TGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFT----GQYCDSLYV  223

Query  412   CTTTNMCLNGMCINEDG--SFKCICKPGFVLAPNGRYC-TDIDECQTSGICMNGHCINTE  468
                 + C+NG    + G  +F+C C PGF     G  C  +ID+C        G C++  
Sbjct  224   PCAPSPCVNGGTCRQTGDFTFECNCLPGF----EGSTCERNIDDCPNHRCQNGGVCVDGV  279

Query  469   GSFRCECPPGLA---------------------------VGVDGRVCVDTHMRSTCYGGI  501
              ++ C CPP                               G  G VCV+      C   I
Sbjct  280   NTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENI  339

Query  502   KKGACVRPFPGA-----VTKSECCCANPDYGF---------GEPCHPCPAKNSAEFHG--  545
                A     PG+     V    C C     G            PCH     ++   +G  
Sbjct  340   DDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQY  399

Query  546   --LCSSGIGITVDGRDINECAL-DPDICSN-GICENLRGSYRCNCNSGYEPDPSGRNC-V  600
                C  G        D++ECA+ + + C + G C N  G++ C C  GY    +G  C +
Sbjct  400   ICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGY----AGPRCEM  455

Query  601   DIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCE-DINECESSPCV-NGACR  658
             DI+EC  +    ++  C +  G ++C C  G+    +   CE +INEC+S+PCV NG C 
Sbjct  456   DINECHSDPCQ-NDATCLDKIGGFTCLCMPGF----KGVHCELEINECQSNPCVNNGQCV  510

Query  659   NNLGSFNCECSPGSKLDSTGLIC---IDSLKGTCWLNIQDSRCEVNINGATLKSECCAT-  714
             + +  F C C PG     TG +C   ID    T  LN   ++C  + NG   +   CAT 
Sbjct  511   DKVNRFQCLCPPG----FTGPVCQIDIDDCSSTPCLN--GAKCIDHPNGYECQ---CATG  561

Query  715   -LGAAWGSPCERCELDT----ACSRGFARVN--------GVTCED-VNECDVFPGVCPNG  760
               G       + C+ D      C  G             G  C D ++EC   P +  +G
Sbjct  562   FTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCL-NDG  620

Query  761   RCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSV-PGKFRMDACCCA  819
             RCI+    + C C       GT  V  +I  + C      + CI  +        +C C+
Sbjct  621   RCIDLVNGYQCNC-----QPGTSGVNCEINFDDCA----SNPCIHGICMDGINRYSCVCS  671

Query  820   ---VGAAWGSDCEECPKPDTKE----------YEALCPRGPGFSNRGDILTGRPFYKDIN  866
                 G     D +EC     ++          +  +CP GP   +          Y  +N
Sbjct  672   PGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPS---------CYSQVN  722

Query  867   ECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNC-TDIDECWISPDLCGSGTCVNT  925
             EC   P  C++G C   +  +KC C++G+       NC  D +EC  +P   G GTC N 
Sbjct  723   ECLSNP--CIHGNCTGGLSGYKCLCDAGWV----GINCEVDKNECLSNPCQNG-GTCDNL  775

Query  926   PGSFECECFDGYESGFMMMKNC-MDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHE---  981
                + C C  G++ G+    NC ++IDEC  NP L   GTC +    + C C L +    
Sbjct  776   VNGYRCTCKKGFK-GY----NCQVNIDECASNPCL-NQGTCFDDISGYTCHCVLPYTGKN  829

Query  982   ----LSP-SREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDE  1036
                 L+P S   C +   C  S +            +Y C C  G+Q    +R   DIDE
Sbjct  830   CQTVLAPCSPNPCENAAVCKESPNF----------ESYTCLCAPGWQG---QRCTIDIDE  876

Query  1037  CMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGE  1096
             C+      H  C N++GSY C C  G++ M D     DID+C +NP   +GG C +    
Sbjct  877   CISKPCMNHGLCHNTQGSYMCECPPGFSGM-DCE--EDIDDCLANP-CQNGGSCMDGVNT  932

Query  1097  YRCLCYDGFMA---SMDMKTCI-------------------------DVNECDLNSNICM  1128
             + CLC  GF       DM  C+                         D   C+ N N C 
Sbjct  933   FSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINECT  992

Query  1129  F------GECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSF  1182
                    G C +   SF C C +G++   G+    +++EC   +H C    +CV+  G++
Sbjct  993   ESSCFNGGTCVDGINSFSCLCPVGFT---GSFCLHEINEC--SSHPCLNEGTCVDGLGTY  1047

Query  1183  KCSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTG-----DGFT  1237
             +CSC  G+ G   + + ++ CS     C     CV       C C  G+ G        +
Sbjct  1048  RCSCPLGYTGKNCQTL-VNLCSRSP--CKNKGTCVQKKAESQCLCPSGWAGAYCDVPNVS  1104

Query  1238  CSDVDECAENV---HLCEN-GQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICV  1293
             C D+      V   HLC++ G C+N    + C+C +G+T    S   + ++EC+  N C 
Sbjct  1105  C-DIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLGYT---GSYCEEQLDECA-SNPCQ  1159

Query  1294  FG-TCNNLPGMFHCICDDGYELDRTGGNCT-DVDECADPINCVNGLCVNTPGRYECNCPP  1351
              G TC++  G + C C  GY+    G NC  +VDEC +      G C++    ++C+CPP
Sbjct  1160  HGATCSDFIGGYRCECVPGYQ----GVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPP  1215

Query  1352  DFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIG-------VGVSRSSCCCSLGKA  1404
               +    G+ C +N + +C    GP       C   IG        G +   C   + + 
Sbjct  1216  GTR----GLLCEEN-IDDC--ARGPHCLNGGQCMDRIGGYSCRCLPGFAGERCEGDINEC  1268

Query  1405  WGNPCETCPPVNSTEY--NTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCI---N  1459
               NPC +   ++  +   + LC     F           +D C ++P L  GG C    N
Sbjct  1269  LSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETF---VDVCPQMPCL-NGGTCAVASN  1324

Query  1460  TFGSFQCECPKGY  1472
                 F C CP G+
Sbjct  1325  MPDGFICRCPPGF  1337


 Score = 189 bits (479),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 292/1019 (29%), Positives = 430/1019 (42%), Gaps = 203/1019 (20%)

Query  1095  GEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTT  1154
             G   C C +GF+     + C   + C+ N        C+N  G+ +    LG +  +  +
Sbjct  47    GTGYCKCPEGFLG----EYCQHRDPCEKN-------RCQN-GGTCVAQAMLGKATCRCAS  94

Query  1155  GCTDVDECEIGAHNCDMHASCVN-------VPGSFKCSCREGWVGNGIKCIDLDECSNGT  1207
             G T  D     +H C +   C+N          +++C+C+ G+ G   +C   D C   +
Sbjct  95    GFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGK--ECQWTDACL--S  150

Query  1208  HQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECAENVHLCENGQCLNVPGAYRCEC  1267
             H C+  + C      + C C+ GFTG     +DV+EC    H    G CLN+PG+Y+C+C
Sbjct  151   HPCANGSTCTTVANQFSCKCLTGFTGQKCE-TDVNECDIPGHCQHGGTCLNLPGSYQCQC  209

Query  1268  EMGFTPASDSKSCQDINECSFQNICVF-GTCNNLPGM-FHCICDDGYELDRTGGNC-TDV  1324
               GFT     + C  +      + CV  GTC       F C C  G+E    G  C  ++
Sbjct  210   PQGFT----GQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFE----GSTCERNI  261

Query  1325  DECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSC  1384
             D+C +      G+CV+    Y C CPP +    TG  C ++ V  C L+     +G    
Sbjct  262   DDCPNHRCQNGGVCVDGVNTYNCRCPPQW----TGQFCTED-VDECLLQPNACQNGGTCA  316

Query  1385  NTEIGVG---------------------------------VSRSSCCCSLGKA-------  1404
             N   G G                                 V+  SC C  GKA       
Sbjct  317   NRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLD  376

Query  1405  ---WGNPCET-----CPPVNSTEYNTLCPGGEGFRPNPITIILEDIDECQEL-PGLCQ-G  1454
                  NPC         P+N  +Y   CP  +G++    T   ED+DEC       C+  
Sbjct  377   DACISNPCHKGALCDTNPLNG-QYICTCP--QGYKGADCT---EDVDECAMANSNPCEHA  430

Query  1455  GNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEY  1514
             G C+NT G+F CEC KGY      R   DI+EC + P      TC + +G +TC+C P  
Sbjct  431   GKCVNTDGAFHCECLKGY---AGPRCEMDINECHSDP-CQNDATCLDKIGGFTCLCMP--  484

Query  1515  MQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPG  1574
                                 + G  CE E+  N  +   C   N G+  +K         
Sbjct  485   -------------------GFKGVHCELEI--NECQSNPC--VNNGQCVDK---------  512

Query  1575  TAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICANGV-CINQIGSFRCECPTGFSYN  1633
                F+ +C   PGFT  +     +DID+C   P  C NG  CI+    + C+C TGF+  
Sbjct  513   VNRFQCLCP--PGFTGPVCQ---IDIDDCSSTP--CLNGAKCIDHPNGYECQCATGFTG-  564

Query  1634  DLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDR-NECLEIPN  1692
               +L  E+ID C   D     +  C +   SY C C  G+       C D+ +EC   P 
Sbjct  565   --VLCEENIDNC---DPDPCHHGQCQDGIDSYTCICNPGYM---GAICSDQIDECYSSPC  616

Query  1693  VCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYP  1752
             + + G C+D+   Y+C C  G      +   ++ D+C  +PC +G C + +  Y+C+C P
Sbjct  617   L-NDGRCIDLVNGYQCNCQPGTSGVNCE---INFDDCASNPCIHGICMDGINRYSCVCSP  672

Query  1753  GFELTHNNDCMDIDECSSFFGQVCRNGR-CFNEIGSFKCLCNEGYELTLDGKNCI-DTNE  1810
             GF     N  +DIDEC+S     CR G  C N +  F+C+C EG        +C    NE
Sbjct  673   GFTGQRCN--IDIDECAS---NPCRKGATCINGVNGFRCICPEGPH----HPSCYSQVNE  723

Query  1811  CVALPGSCSPGTCQNLEGSFRCICPPGYEVKSESCIDINECNEDPNICLF-GSCTNTPGG  1869
             C++ P  C  G C      ++C+C  G+ V     +D NEC  +P  C   G+C N   G
Sbjct  724   CLSNP--CIHGNCTGGLSGYKCLCDAGW-VGINCEVDKNECLSNP--CQNGGTCDNLVNG  778

Query  1870  FQCICPTGFVLSDNGRRCFDTRQSFCFTN--FENGKCSVPKAFNTTKAKCCCSKMPGEGW  1927
             ++C C  GF     G  C       C +N     G C     F+      C   +P  G 
Sbjct  779   YRCTCKKGF----KGYNC-QVNIDECASNPCLNQGTC-----FDDISGYTCHCVLPYTGK  828

Query  1928  G-----DPCELCPKEEEVAFQDLCPYGHGT---IPGIDDTR--EDVNECLESPGVCSNGH  1977
                    PC   P E     ++   +   T    PG    R   D++EC+  P + ++G 
Sbjct  829   NCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCM-NHGL  887

Query  1978  CINTDGSFRCECPMGYNLDYTGVHC-IDTDECSIGNPCGN-GTCTNVIGSFECNCHEGF  2034
             C NT GS+ CECP G    ++G+ C  D D+C + NPC N G+C + + +F C C  GF
Sbjct  888   CHNTQGSYMCECPPG----FSGMDCEEDIDDC-LANPCQNGGSCMDGVNTFSCLCLPGF  941


 Score = 166 bits (421),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 315/1103 (29%), Positives = 460/1103 (42%), Gaps = 216/1103 (20%)

Query  66    QDVDEC-QAIPGVCQ-GGNCINTVGSYECKCPAGHKQNEATQKCD-DIDECSIIPGICEG  122
             +DVDEC  A    C+  G C+NT G++ C+C  G+    A  +C+ DI+EC   P  C+ 
Sbjct  414   EDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGY----AGPRCEMDINECHSDP--CQN  467

Query  123   -SECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSN--IVNGRCAQELPGRFTKRQC  179
              + C + +G + C+C  G+     G  C +   + C SN  + NG+C  ++  RF   QC
Sbjct  468   DATCLDKIGGFTCLCMPGF----KGVHC-ELEINECQSNPCVNNGQCVDKV-NRF---QC  518

Query  180   CCESGRCWAMGSVPEMCPVRGSDEYRRLCVDGAPAGGGSRGG----GTGGNGFLPSGNGN  235
              C  G     G V   C +   D     C++GA       G      TG  G L   N +
Sbjct  519   LCPPG---FTGPV---CQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGVLCEENID  572

Query  236   GHGHGPRGAGFIPIPGSNGFS----PGVGGAGVGTGSSTGNGPIITGLTILNQTIDICKH  291
                  P   G     G + ++    PG  GA                  I +  ID C  
Sbjct  573   NCDPDPCHHGQCQ-DGIDSYTCICNPGYMGA------------------ICSDQIDECYS  613

Query  292   HPDLCLN-GRCIPTLSSYRCECNMGYKQDSNGDC-TDVDECTSNPCSNGDCVNTPGSYYC  349
              P  CLN GRCI  ++ Y+C C  G    S  +C  + D+C SNPC +G C++    Y C
Sbjct  614   SP--CLNDGRCIDLVNGYQCNCQPG---TSGVNCEINFDDCASNPCIHGICMDGINRYSC  668

Query  350   KCHAGFQRTPTKQAC-IDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVD  408
              C  GF    T Q C IDIDEC  N    K   C+N    F+CIC  G        +C  
Sbjct  669   VCSPGF----TGQRCNIDIDECASNPCR-KGATCINGVNGFRCICPEG----PHHPSCYS  719

Query  409   HDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYC-TDIDECQTSGICMNGHCINT  467
                   +N C++G C      +KC+C  G+V    G  C  D +EC ++     G C N 
Sbjct  720   QVNECLSNPCIHGNCTGGLSGYKCLCDAGWV----GINCEVDKNECLSNPCQNGGTCDNL  775

Query  468   EGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYG  527
                +RC C  G   G + +V +D    + C   + +G C     G      C C  P  G
Sbjct  776   VNGYRCTCKKGFK-GYNCQVNIDECASNPC---LNQGTCFDDISGYT----CHCVLPYTG  827

Query  528   -----FGEPCHPCPAKNSA---------EFHGLCSSGIGITVDGRDINECALDPDICSNG  573
                     PC P P +N+A          +  LC+ G        DI+EC   P + ++G
Sbjct  828   KNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCM-NHG  886

Query  574   ICENLRGSYRCNCNSGYEPDPSGRNC-VDIDECSVNRLLCDN-GLCRNTPGSYSCTCPKG  631
             +C N +GSY C C  G+    SG +C  DID+C  N   C N G C +   ++SC C  G
Sbjct  887   LCHNTQGSYMCECPPGF----SGMDCEEDIDDCLANP--CQNGGSCMDGVNTFSCLCLPG  940

Query  632   YVFSTETDTCE-DINECESSPCVN-GACRNNLGSFNCECSPGSKLDSTGLICIDSLKGTC  689
             +      D C+ D+NEC S PC N G C + + S+ C+C  G                  
Sbjct  941   FT----GDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAG------------------  978

Query  690   WLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVNGVTCEDVNE  749
                     CE NIN  T +S C        G     C     C  GF         ++NE
Sbjct  979   ---FDGVHCENNINECT-ESSCFNGGTCVDGINSFSC----LCPVGF--TGSFCLHEINE  1028

Query  750   CDVFPGVCPN-GRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLT--WDEDECIRS  806
             C   P  C N G C++  G++ C CP G     TG+ C  + +  C  +   ++  C++ 
Sbjct  1029  CSSHP--CLNEGTCVDGLGTYRCSCPLGY----TGKNCQTL-VNLCSRSPCKNKGTCVQ-  1080

Query  807   VPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFYKDIN  866
                K     C C  G A G+ C+                 P  S   DI   R      +
Sbjct  1081  ---KKAESQCLCPSGWA-GAYCDV----------------PNVS--CDIAASRRGVLVEH  1118

Query  867   ECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTP  926
              C+       +G C N   +  C+C  G+T    E     +DEC  +P   G+ TC +  
Sbjct  1119  LCQ------HSGVCINAGNTHYCQCPLGYTGSYCEEQ---LDECASNPCQHGA-TCSDFI  1168

Query  927   GSFECECFDGYESGFMMMKNC-MDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPS  985
             G + CEC  GY+       NC  ++DEC+  P    GGTC++    F+C CP G      
Sbjct  1169  GGYRCECVPGYQG-----VNCEYEVDECQNQPCQ-NGGTCIDLVNHFKCSCPPGTRGLLC  1222

Query  986   REECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCH  1045
              E   ++++C+        G+C++ +G Y C C  G+      R   DI+EC+       
Sbjct  1223  EE---NIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAG---ERCEGDINECL-------  1269

Query  1046  THCTNSEGSYEC-SCSDGYALMPDVRTCADIDECESNPDIC------DGGQC---TNIPG  1095
             ++  +SEGS +C   ++ Y  +   R+      CE+  D+C      +GG C   +N+P 
Sbjct  1270  SNPCSSEGSLDCIQLTNDYLCV--CRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPD  1327

Query  1096  EYRCLCYDGFMASMDMKTCIDVN  1118
              + C C  GF  +    +C  V 
Sbjct  1328  GFICRCPPGFSGARCQSSCGQVK  1350


 Score = 146 bits (368),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 285/1004 (28%), Positives = 398/1004 (40%), Gaps = 196/1004 (20%)

Query  58    PNIRTGACQ-DVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSII  116
             P      CQ D+D+C + P +  G  CI+    YEC+C  G       +  D+ D     
Sbjct  522   PGFTGPVCQIDIDDCSSTPCL-NGAKCIDHPNGYECQCATGFTGVLCEENIDNCD-----  575

Query  117   PGICEGSECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSN--IVNGRCAQELPGRF  174
             P  C   +C + + SY CIC  GY+    G+ C DQ    C+S+  + +GRC   + G  
Sbjct  576   PDPCHHGQCQDGIDSYTCICNPGYM----GAICSDQ-IDECYSSPCLNDGRCIDLVNGY-  629

Query  175   TKRQCCCESGRCWAMGSVPEMCPVRGSDEYRRLCVDGAPAGGGSRGGGTGGNGFLPSG--  232
                QC C+       G+    C +   D     C+ G    G +R       GF      
Sbjct  630   ---QCNCQP------GTSGVNCEINFDDCASNPCIHGICMDGINRYSCVCSPGFTGQRCN  680

Query  233   -NGNGHGHGPRGAGFIPIPGSNGFSPGVGGAGVGTGSSTGNGPIITGLTILNQTIDICKH  291
              + +     P   G   I G NGF                 GP           ++ C  
Sbjct  681   IDIDECASNPCRKGATCINGVNGFR-----------CICPEGPHHPSCY---SQVNECLS  726

Query  292   HPDLCLNGRCIPTLSSYRCECNMGYKQDSNGDC-TDVDECTSNPCSNG-DCVNTPGSYYC  349
             +P  C++G C   LS Y+C C+ G+      +C  D +EC SNPC NG  C N    Y C
Sbjct  727   NP--CIHGNCTGGLSGYKCLCDAGW---VGINCEVDKNECLSNPCQNGGTCDNLVNGYRC  781

Query  350   KCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDH  409
              C  GF+    +   ++IDEC  N  L   G C +    + C C     L   GKNC   
Sbjct  782   TCKKGFKGYNCQ---VNIDECASNPCL-NQGTCFDDISGYTCHC----VLPYTGKNCQTV  833

Query  410   DECTTTNMCLNGMCINEDGSFK---CICKPGFVLAPNGRYCT-DIDECQTSGICMN-GHC  464
                 + N C N     E  +F+   C+C PG+     G+ CT DIDEC  S  CMN G C
Sbjct  834   LAPCSPNPCENAAVCKESPNFESYTCLCAPGW----QGQRCTIDIDEC-ISKPCMNHGLC  888

Query  465   INTEGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANP  524
              NT+GS+ CECPPG + G+D    +D  + + C  G   G+C+    G  T         
Sbjct  889   HNTQGSYMCECPPGFS-GMDCEEDIDDCLANPCQNG---GSCMD---GVNT---------  932

Query  525   DYGFGEPCHPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICSN-GICENLRGSYR  583
                               F  LC  G        D+NEC  +P  C N G C +   SY 
Sbjct  933   ------------------FSCLCLPGFTGDKCQTDMNECLSEP--CKNGGTCSDYVNSYT  972

Query  584   CNCNSGYEPDPSGRNCV-DIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCE  642
             C C +G++    G +C  +I+EC+ +    + G C +   S+SC CP G+   T +    
Sbjct  973   CKCQAGFD----GVHCENNINECTESSCF-NGGTCVDGINSFSCLCPVGF---TGSFCLH  1024

Query  643   DINECESSPCVN-GACRNNLGSFNCECS---PGSKLDSTGLICIDSL---KGTCWLNIQD  695
             +INEC S PC+N G C + LG++ C C     G    +   +C  S    KGTC     +
Sbjct  1025  EINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAE  1084

Query  696   SRCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVNGVTCEDVNECDVFPG  755
             S+C      A          GA    P   C  D A SR      GV  E + +      
Sbjct  1085  SQCLCPSGWA----------GAYCDVPNVSC--DIAASR-----RGVLVEHLCQ------  1121

Query  756   VCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRMDA  815
                +G CIN+  + +C+CP G     TG  C +   E                G +R   
Sbjct  1122  --HSGVCINAGNTHYCQCPLGY----TGSYCEEQLDECASNPCQHGATCSDFIGGYR---  1172

Query  816   CCCAVGAAWGSDCE----ECPKPD----------TKEYEALCPRGPGFSNRGDILTGRPF  861
              C  V    G +CE    EC                 ++  CP G     RG +      
Sbjct  1173  -CECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPG----TRGLLCE----  1223

Query  862   YKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISP-DLCGSG  920
              ++I++C   P     G+C + IG + C+C  GF     ER   DI+EC  +P    GS 
Sbjct  1224  -ENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFA---GERCEGDINECLSNPCSSEGSL  1279

Query  921   TCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCV---NTEGSFQCDCP  977
              C+     + C C     S F        +D C + P L  GGTC    N    F C CP
Sbjct  1280  DCIQLTNDYLCVC----RSAFTGRHCETFVDVCPQMPCL-NGGTCAVASNMPDGFICRCP  1334

Query  978   LGHELSPSREECIDVNECSLSDSLCRNG-KCVNMVGTYQCSCNS  1020
              G   +  +  C  V         CR G +CV+     +C C S
Sbjct  1335  PGFSGARCQSSCGQVK--------CRKGEQCVHTASGPRCFCPS  1370


> sp|P46531|NOTC1_HUMAN Neurogenic locus notch homolog protein 
1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4
Length=2555

 Score = 236 bits (602),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 376/1283 (29%), Positives = 530/1283 (41%), Gaps = 252/1283 (20%)

Query  875   CMNGKCRN-------TIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPG  927
             C+   CRN       T+  +KC+C  G++     ++C   D C  +P   G G C+    
Sbjct  106   CLTNPCRNGGTCDLLTLTEYKCRCPPGWS----GKSCQQADPCASNPCANG-GQCLPFEA  160

Query  928   SFECECFDGYESGFMMMKNCMDIDECERNPLLCR-GGTCVNTEGSFQCDCPLGHELSPSR  986
             S+ C C   +           D++EC + P LCR GGTC N  GS++C C   H   P+ 
Sbjct  161   SYICHCPPSFHGPTCRQ----DVNECGQKPGLCRHGGTCHNEVGSYRCVCRATH-TGPNC  215

Query  987   EECIDVNECSLSDSLCRNGKCVNMVG--TYQCSCNSGYQATPDRRSCTD-IDECMIMNGG  1043
             E          S S C+NG      G  T++C+C  G+      ++C + ID+C   N  
Sbjct  216   ERPY----VPCSPSPCQNGGTCRPTGDVTHECACLPGFTG----QNCEENIDDCPGNNCK  267

Query  1044  CHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDIC-DGGQCTNIPGEYRCLCY  1102
                 C +   +Y C C   +          D+DEC+  P+ C +GG C N  G Y C+C 
Sbjct  268   NGGACVDGVNTYNCRCPPEWTGQ---YCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCV  324

Query  1103  DGF--------------MASMDMKTCIDVNE--------------CDLN----SNICMFG  1130
             +G+               A     TC D                 C LN    SN C  G
Sbjct  325   NGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEG  384

Query  1131  ---ECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCR  1187
                +     G  IC C  GY+   G     DVDEC +GA+ C+    C+N  GSF+C C 
Sbjct  385   SNCDTNPVNGKAICTCPSGYT---GPACSQDVDECSLGANPCEHAGKCINTLGSFECQCL  441

Query  1188  EGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCS-DVDECAE  1246
             +G+ G   + ID++EC   ++ C  +A C++  G + C C+ G+  +G  C  + DECA 
Sbjct  442   QGYTGPRCE-IDVNECV--SNPCQNDATCLDQIGEFQCICMPGY--EGVHCEVNTDECAS  496

Query  1247  NVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQ-DINECSFQNICVFGTCNNLPGMFH  1305
             +  L  NG+CL+    ++CEC  GFT       CQ D++EC+         C + P  + 
Sbjct  497   SPCL-HNGRCLDKINEFQCECPTGFT----GHLCQYDVDECASTPCKNGAKCLDGPNTYT  551

Query  1306  CICDDGYELDRTGGNC-TDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVD  1364
             C+C +GY    TG +C  D+DEC DP  C  G C +    + C C P +    TG  C  
Sbjct  552   CVCTEGY----TGTHCEVDIDEC-DPDPCHYGSCKDGVATFTCLCRPGY----TGHHCET  602

Query  1365  N---------RVG-------NCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCS---LGKAW  1405
             N         R G       N YL +  +G    +C  EI +    SS C S   L K  
Sbjct  603   NINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNC--EINLDDCASSPCDSGTCLDKID  660

Query  1406  GNPCETCPPVNSTEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQ  1465
             G  C   P    +  N                   +IDEC   P    GG C +    F 
Sbjct  661   GYECACEPGYTGSMCNI------------------NIDECAGNP-CHNGGTCEDGINGFT  701

Query  1466  CECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVN-------  1518
             C CP+GY+   +     +++EC ++P  C  G C ++L  Y C C P +   N       
Sbjct  702   CRCPEGYH---DPTCLSEVNECNSNP--CVHGACRDSLNGYKCDCDPGWSGTNCDINNNE  756

Query  1519  -------GGHNCMDMRKSF---CYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCE  1568
                     G  C DM   +   C   ++G +C+     N+ +    C  N          
Sbjct  757   CESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQT----NINE----CASN----------  798

Query  1569  PCPTPGTAEFKNICGNIPGFT---FDIHSGKAVDIDECKEIPGICANGVCINQ---IGSF  1622
             PC   GT        ++ G+       ++G   ++      P  C NG    Q     SF
Sbjct  799   PCLNQGTC-----IDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESF  853

Query  1623  RCECPTGFSYNDLLLVCE-DIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGAC  1681
              C CPTG+        CE DI+EC    + C+  A C N+ G YRC C AG+  S     
Sbjct  854   SCVCPTGWQGQ----TCEVDINECVL--SPCRHGASCQNTHGGYRCHCQAGY--SGRNCE  905

Query  1682  VDRNECLEIPNVCSHG-LCVDMQGSYKCICHNGFKASQDQTMCM-DVDECERHPCGNGT-  1738
              D ++C   PN C +G  C D   +  C C  GF+     T C  D++EC   PC NG  
Sbjct  906   TDIDDCR--PNPCHNGGSCTDGINTAFCDCLPGFRG----TFCEEDINECASDPCRNGAN  959

Query  1739  CKNTVGSYNCLCYPGFELTH-NNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYE  1797
             C + V SY C C  GF   H  N+  D  E S F G     G C + I SF CLC  G+ 
Sbjct  960   CTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNG-----GTCVDGINSFTCLCPPGFT  1014

Query  1798  LTLDGKNCI-DTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSESCIDINECNEDPN  1856
                 G  C  D NEC + P     GTCQ+  GS+RC CP GY     +C ++    +   
Sbjct  1015  ----GSYCQHDVNECDSQP-CLHGGTCQDGCGSYRCTCPQGY--TGPNCQNLVHWCDSSP  1067

Query  1857  ICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPK--------  1908
                 G C  T   ++C CP+G+     G  C D     C    +     V +        
Sbjct  1068  CKNGGKCWQTHTQYRCECPSGWT----GLYC-DVPSVSCEVAAQRQGVDVARLCQHGGLC  1122

Query  1909  --AFNTTKAKCCCSKMPG--EGWGDPCELCPKEEEVAFQD-LCPYGHGTIPGIDDTR--E  1961
               A NT   +C         E   D C   P +      D L  Y    + G       E
Sbjct  1123  VDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSE  1182

Query  1962  DVNECLESPGVCSNG-HCINTDGSFRCECPMGYNLDYTGVHC-IDTDEC-------SIGN  2012
             +++ECL  P  C NG  C++   +++C CP G      GVHC I+ D+C       S   
Sbjct  1183  EIDECLSHP--CQNGGTCLDLPNTYKCSCPRGTQ----GVHCEINVDDCNPPVDPVSRSP  1236

Query  2013  PC-GNGTCTNVIGSFECNCHEGF  2034
              C  NGTC + +G + C C  GF
Sbjct  1237  KCFNNGTCVDQVGGYSCTCPPGF  1259


 Score = 220 bits (560),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 350/1240 (28%), Positives = 513/1240 (41%), Gaps = 227/1240 (18%)

Query  881   RNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTC-VNTPGSFECECFDGYES  939
             R  +  + C C  GF+  +     T +D   ++      GTC + T   ++C C  G+  
Sbjct  79    RRGVADYACSCALGFSGPL---CLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSG  135

Query  940   GFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSD  999
                  K+C   D C  NP    GG C+  E S+ C CP        R+   DVNEC    
Sbjct  136   -----KSCQQADPCASNPCA-NGGQCLPFEASYICHCPPSFHGPTCRQ---DVNECGQKP  186

Query  1000  SLCRNG-KCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECS  1058
              LCR+G  C N VG+Y+C C + +      R           NGG  T     + ++EC+
Sbjct  187   GLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGG--TCRPTGDVTHECA  244

Query  1059  CSDGYALMPDVRTCAD-IDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDV  1117
             C  G+      + C + ID+C  N +  +GG C +    Y C C   +      +   DV
Sbjct  245   CLPGFT----GQNCEENIDDCPGN-NCKNGGACVDGVNTYNCRCPPEWTGQYCTE---DV  296

Query  1118  NECDLNSNICMFG-ECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCV  1176
             +EC L  N C  G  C NT G + C C  G++   G     ++D+C   A  C   A+C 
Sbjct  297   DECQLMPNACQNGGTCHNTHGGYNCVCVNGWT---GEDCSENIDDCASAA--CFHGATCH  351

Query  1177  NVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSP--GSYLCACVEGFTGD  1234
             +   SF C C  G  G  + C   D C   ++ C+  + C  +P  G  +C C  G+TG 
Sbjct  352   DRVASFYCECPHGRTG--LLCHLNDACI--SNPCNEGSNCDTNPVNGKAICTCPSGYTGP  407

Query  1235  GFTCSDVDECAENVHLCEN-GQCLNVPGAYRCECEMGFTPASDSKSCQ-DINECSFQNIC  1292
               +  DVDEC+   + CE+ G+C+N  G++ C+C  G+T       C+ D+NEC      
Sbjct  408   ACS-QDVDECSLGANPCEHAGKCINTLGSFECQCLQGYT----GPRCEIDVNECVSNPCQ  462

Query  1293  VFGTCNNLPGMFHCICDDGYE----------------------LDR------------TG  1318
                TC +  G F CIC  GYE                      LD+            TG
Sbjct  463   NDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTG  522

Query  1319  GNCT-DVDECADPINCVNGL-CVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYL---K  1373
               C  DVDECA    C NG  C++ P  Y C C   +    TG  C +  +  C      
Sbjct  523   HLCQYDVDECAS-TPCKNGAKCLDGPNTYTCVCTEGY----TGTHC-EVDIDECDPDPCH  576

Query  1374  YGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPN  1433
             YG   DG  +       G +   C  ++ +    PC         +   LC   +G    
Sbjct  577   YGSCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGP  636

Query  1434  PITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICE-DIDECVAHPG  1492
                I   ++D+C   P  C  G C++    ++C C  GY  S    +C  +IDEC  +P 
Sbjct  637   NCEI---NLDDCASSP--CDSGTCLDKIDGYECACEPGYTGS----MCNINIDECAGNPC  687

Query  1493  VCGPGTCYNTLGNYTCICPPEYM------QVN--GGHNCMDMRKSFCYRSYNGTSCENEL  1544
               G GTC + +  +TC CP  Y       +VN    + C+      C  S NG  C+ + 
Sbjct  688   HNG-GTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPCV---HGACRDSLNGYKCDCDP  743

Query  1545  PFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGK--AVDIDE  1602
              ++ T     C  N  +  + PC    T        +C    GF     SG     +I+E
Sbjct  744   GWSGTN----CDINNNECESNPCVNGGTCKDMTSGYVCTCREGF-----SGPNCQTNINE  794

Query  1603  CKEIPGICAN-GVCINQIGSFRCEC--PTGFSYNDLLLVCEDIDECSNGDNLCQRNADCI  1659
             C   P  C N G CI+ +  ++C C  P   +  +++L       C NG   C+++ D  
Sbjct  795   CASNP--CLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGE-CRQSEDY-  850

Query  1660  NSPGSYRCECAAGFKLSPNGAC-VDRNECLEIPNVCSHGL-CVDMQGSYKCICHNGFKAS  1717
                 S+ C C  G++      C VD NEC+  P  C HG  C +  G Y+C C  G+   
Sbjct  851   ---ESFSCVCPTGWQ---GQTCEVDINECVLSP--CRHGASCQNTHGGYRCHCQAGYSGR  902

Query  1718  QDQTMCMDVDECERHPCGNG-TCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSFFGQVC  1776
               +T   D+D+C  +PC NG +C + + +  C C PGF  T   +  DI+EC+S     C
Sbjct  903   NCET---DIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEE--DINECAS---DPC  954

Query  1777  RNG-RCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICP  1835
             RNG  C + + S+ C C  G+       N  D  E     G    GTC +   SF C+CP
Sbjct  955   RNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNG----GTCVDGINSFTCLCP  1010

Query  1836  PGYEVKSESCIDINECNEDPNICLFG-SCTNTPGGFQCICPTGFVLSD------------  1882
             PG+   S    D+NEC+  P  CL G +C +  G ++C CP G+   +            
Sbjct  1011  PGF-TGSYCQHDVNECDSQP--CLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSP  1067

Query  1883  --NGRRCFDTRQSF---CFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKE  1937
               NG +C+ T   +   C + +    C VP                       CE+  + 
Sbjct  1068  CKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVS--------------------CEVAAQR  1107

Query  1938  EEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDY  1997
             + V    LC +G                          G C++   +  C C  GY    
Sbjct  1108  QGVDVARLCQHG--------------------------GLCVDAGNTHHCRCQAGY----  1137

Query  1998  TGVHCID-TDECSIGNPCGNG-TCTNVIGSFECNCHEGFE  2035
             TG +C D  DECS  +PC NG TCT+ +G + C C  G+ 
Sbjct  1138  TGSYCEDLVDECSP-SPCQNGATCTDYLGGYSCKCVAGYH  1176


 Score = 220 bits (560),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 424/1522 (28%), Positives = 604/1522 (40%), Gaps = 383/1522 (25%)

Query  289   CKHHPDLCLNG-RCIPTLSSYRCECNMGYKQDSNGDCTDVDECTSNPCSNG---DCVNTP  344
             C    + CLNG +C     +  C C   +       C D + C S PC N      V+  
Sbjct  24    CSQPGETCLNGGKCEAANGTEACVCGGAFVGPR---CQDPNPCLSTPCKNAGTCHVVDRR  80

Query  345   G--SYYCKCHAGFQ----RTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFE  398
             G   Y C C  GF      TP   AC+  + C +NG  C     + T   ++C C  G+ 
Sbjct  81    GVADYACSCALGFSGPLCLTPLDNACL-TNPC-RNGGTCD----LLTLTEYKCRCPPGWS  134

Query  399   LTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYC-TDIDEC-QTS  456
                 GK+C   D C +      G C+  + S+ C C P F    +G  C  D++EC Q  
Sbjct  135   ----GKSCQQADPCASNPCANGGQCLPFEASYICHCPPSF----HGPTCRQDVNECGQKP  186

Query  457   GICMNG-HCINTEGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVT  515
             G+C +G  C N  GS+RC             VC  TH    C          RP+     
Sbjct  187   GLCRHGGTCHNEVGSYRC-------------VCRATHTGPNCE---------RPY-----  219

Query  516   KSECCCANPDYGFGEPCHPCPAKNSAEFHGLCSSGIGIT-----VDGRDINECALDPDIC  570
                            PC P P +N     G C     +T     + G     C  + D C
Sbjct  220   --------------VPCSPSPCQNG----GTCRPTGDVTHECACLPGFTGQNCEENIDDC  261

Query  571   ------SNGICENLRGSYRCNCNSGYEPDPSGRNCV-DIDECSVNRLLCDNG-LCRNTPG  622
                   + G C +   +Y C C     P+ +G+ C  D+DEC +    C NG  C NT G
Sbjct  262   PGNNCKNGGACVDGVNTYNCRC----PPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHG  317

Query  623   SYSCTCPKGYVFSTETDTCEDINECESSPCVNGA-CRNNLGSFNCECSPGSKLDSTGLIC  681
              Y+C C  G+   T  D  E+I++C S+ C +GA C + + SF CEC  G     TGL+C
Sbjct  318   GYNCVCVNGW---TGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGR----TGLLC  370

Query  682   IDSLKGTCWLNI--QDSRCEVN-INGATLKSECCATLGAAWGSPCERCELDTACSRGFAR  738
                L   C  N   + S C+ N +NG  +      T  + +  P        ACS     
Sbjct  371   --HLNDACISNPCNEGSNCDTNPVNGKAI-----CTCPSGYTGP--------ACS-----  410

Query  739   VNGVTCEDVNECDVFPGVCPN-GRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLT  797
                   +DV+EC +    C + G+CIN+ GSF C+C +G T    G  C +I + +C   
Sbjct  411   ------QDVDECSLGANPCEHAGKCINTLGSFECQCLQGYT----GPRC-EIDVNECVSN  459

Query  798   --WDEDECIRSVPGKFRMDACCCAVGAAWGSDCE----ECPKP----------DTKEYEA  841
                ++  C+  + G+F+   C C  G   G  CE    EC                E++ 
Sbjct  460   PCQNDATCLDQI-GEFQ---CICMPGYE-GVHCEVNTDECASSPCLHNGRCLDKINEFQC  514

Query  842   LCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNG-KCRNTIGSFKCKCNSGFTLDME  900
              CP G          TG     D++EC   P  C NG KC +   ++ C C  G+T    
Sbjct  515   ECPTG---------FTGHLCQYDVDECASTP--CKNGAKCLDGPNTYTCVCTEGYTGTHC  563

Query  901   ERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLC  960
             E    DIDEC   PD C  G+C +   +F C C  GY +G     N   I+EC   P  C
Sbjct  564   E---VDIDEC--DPDPCHYGSCKDGVATFTCLCRPGY-TGHHCETN---INECSSQP--C  612

Query  961   R-GGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCN  1019
             R GGTC + + ++ C C L     P+ E  I++++C+   S C +G C++ +  Y+C+C 
Sbjct  613   RHGGTCQDRDNAYLCFC-LKGTTGPNCE--INLDDCA--SSPCDSGTCLDKIDGYECACE  667

Query  1020  SGYQATPDRRSCTDIDECM---IMNGG---------------------------------  1043
              GY  +       +IDEC      NGG                                 
Sbjct  668   PGYTGS---MCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNP  724

Query  1044  -CHTHCTNSEGSYECSCSDGYALMPDVRTCADID--ECESNPDICDGGQCTNIPGEYRCL  1100
               H  C +S   Y+C C  G++      T  DI+  ECESNP + +GG C ++   Y C 
Sbjct  725   CVHGACRDSLNGYKCDCDPGWS-----GTNCDINNNECESNPCV-NGGTCKDMTSGYVCT  778

Query  1101  CYDGFMAS--------------MDMKTCIDV--------------NECDLNSNICMF---  1129
             C +GF                 ++  TCID                 C++    C     
Sbjct  779   CREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPC  838

Query  1130  ---GECENTKG--SFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKC  1184
                GEC  ++   SF C C  G+   +G T   D++EC +    C   ASC N  G ++C
Sbjct  839   RNGGECRQSEDYESFSCVCPTGW---QGQTCEVDINECVLSP--CRHGASCQNTHGGYRC  893

Query  1185  SCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDEC  1244
              C+ G+ G   +  D+D+C    + C     C +   +  C C+ GF G  F   D++EC
Sbjct  894   HCQAGYSGRNCE-TDIDDCR--PNPCHNGGSCTDGINTAFCDCLPGFRGT-FCEEDINEC  949

Query  1245  AENVHLCENG-QCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGM  1303
             A +   C NG  C +   +Y C C  GF+      +  D  E S  N    GTC +    
Sbjct  950   ASDP--CRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFN---GGTCVDGINS  1004

Query  1304  FHCICDDGYELDRTGGNCT-DVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGC  1362
             F C+C  G+    TG  C  DV+EC        G C +  G Y C CP  +    TG  C
Sbjct  1005  FTCLCPPGF----TGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGY----TGPNC  1056

Query  1363  VDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNT  1422
               N V  C                        SS C + GK W            T+Y  
Sbjct  1057  -QNLVHWC-----------------------DSSPCKNGGKCW---------QTHTQYRC  1083

Query  1423  LCPGG-EGFRPNPITIILEDIDECQ--ELPGLCQ-GGNCINTFGSFQCECPKGYYLSEET  1478
              CP G  G   +  ++  E   + Q  ++  LCQ GG C++   +  C C  GY  S   
Sbjct  1084  ECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGS---  1140

Query  1479  RICED-IDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNG  1537
               CED +DEC   P   G  TC + LG Y+C C   Y  VN      ++ +   +   NG
Sbjct  1141  -YCEDLVDECSPSPCQNG-ATCTDYLGGYSCKCVAGYHGVNCSE---EIDECLSHPCQNG  1195

Query  1538  TSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKA  1597
              +C  +LP N  K  C                                P  T  +H    
Sbjct  1196  GTCL-DLP-NTYKCSC--------------------------------PRGTQGVHCEIN  1221

Query  1598  VD-----IDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCE-DIDECSNGDNL  1651
             VD     +D     P    NG C++Q+G + C CP GF    +   CE D++EC +    
Sbjct  1222  VDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGF----VGERCEGDVNECLSNPCD  1277

Query  1652  CQRNADCINSPGSYRCECAAGF  1673
              +   +C+     + CEC AG 
Sbjct  1278  ARGTQNCVQRVNDFHCECRAGH  1299


 Score = 219 bits (557),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 355/1207 (29%), Positives = 509/1207 (42%), Gaps = 241/1207 (20%)

Query  326   DVDECT--SNPCSN-GDCVNTPGSYYCKCHAGFQRTPTKQAC-IDIDECIQNGVLCKN-G  380
             DVDEC+  +NPC + G C+NT GS+ C+C  G+    T   C ID++EC+ N   C+N  
Sbjct  412   DVDECSLGANPCEHAGKCINTLGSFECQCLQGY----TGPRCEIDVNECVSNP--CQNDA  465

Query  381   RCVNTDGSFQCICNAGFELTTDGKNC-VDHDECTTTNMCLNGMCINEDGSFKCICKPGFV  439
              C++  G FQCIC  G+E    G +C V+ DEC ++    NG C+++   F+C C  GF 
Sbjct  466   TCLDQIGEFQCICMPGYE----GVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFT  521

Query  440   LAPNGRYCT-DIDECQTSGICMNGHCINTEGSFRCECPPGLAVGVDGRVCVDTHMRSTC-  497
                 G  C  D+DEC ++       C++   ++ C C  G   G    V +D      C 
Sbjct  522   ----GHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGY-TGTHCEVDIDECDPDPCH  576

Query  498   YGGIKKGACVRP---FPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGLCSSGIGIT  554
             YG  K G         PG       C  N +    +PC         +   LC    G T
Sbjct  577   YGSCKDGVATFTCLCRPGYTGHH--CETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTT  634

Query  555   VDGRDIN--ECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNC-VDIDECSVNRLL  611
                 +IN  +CA  P  C +G C +    Y C C  GY    +G  C ++IDEC+ N   
Sbjct  635   GPNCEINLDDCASSP--CDSGTCLDKIDGYECACEPGY----TGSMCNINIDECAGNP--  686

Query  612   CDNG-LCRNTPGSYSCTCPKGYVFSTETDTC-EDINECESSPCVNGACRNNLGSFNCECS  669
             C NG  C +    ++C CP+GY       TC  ++NEC S+PCV+GACR++L  + C+C 
Sbjct  687   CHNGGTCEDGINGFTCRCPEGY----HDPTCLSEVNECNSNPCVHGACRDSLNGYKCDCD  742

Query  670   PGSKLDSTGLICIDSLKGTCWLNIQDSRCEVN--INGATLKSECCATLGAAWGSPCERCE  727
             PG     +G  C          +I ++ CE N  +NG T K      +            
Sbjct  743   PG----WSGTNC----------DINNNECESNPCVNGGTCKDMTSGYV------------  776

Query  728   LDTACSRGFARVNGVTCEDVNECDVFPGVCPN-GRCINSRGSFHCECPEGLTLDGTGRVC  786
                 C  GF+  N  T  ++NEC   P  C N G CI+    + C C     L  TG  C
Sbjct  777   --CTCREGFSGPNCQT--NINECASNP--CLNQGTCIDDVAGYKCNC----LLPYTGATC  826

Query  787   LDIRMEQCYLTWDEDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRG  846
              ++ +  C             P   R            G +C +    D + +  +CP G
Sbjct  827   -EVVLAPC------------APSPCRN-----------GGECRQ--SEDYESFSCVCPTG  860

Query  847   PGFSNRGDILTGRPFYKDINECKVFPGMCMNG-KCRNTIGSFKCKCNSGFTLDMEERNC-  904
                        G+    DINEC + P  C +G  C+NT G ++C C +G++     RNC 
Sbjct  861   ---------WQGQTCEVDINECVLSP--CRHGASCQNTHGGYRCHCQAGYS----GRNCE  905

Query  905   TDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCR-GG  963
             TDID+C  +P   G G+C +   +  C+C  G+   F       DI+EC  +P  CR G 
Sbjct  906   TDIDDCRPNPCHNG-GSCTDGINTAFCDCLPGFRGTFCE----EDINECASDP--CRNGA  958

Query  964   TCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRN-GKCVNMVGTYQCSCNSGY  1022
              C +   S+ C CP G           D  E S     C N G CV+ + ++ C C  G+
Sbjct  959   NCTDCVDSYTCTCPAGFSGIHCENNTPDCTESS-----CFNGGTCVDGINSFTCLCPPGF  1013

Query  1023  QATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNP  1082
               +  +    + D    ++GG    C +  GSY C+C  GY   P+ +    +  C+S+P
Sbjct  1014  TGSYCQHDVNECDSQPCLHGGT---CQDGCGSYRCTCPQGYT-GPNCQNL--VHWCDSSP  1067

Query  1083  DICDGGQCTNIPGEYRCLCYDGF------MASMDMKTCIDVNECDLNSNICMFGECENTK  1136
                +GG+C     +YRC C  G+      + S+  +        D+       G C +  
Sbjct  1068  -CKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAG  1126

Query  1137  GSFICHCQLGYSVKKGTTGCTD-VDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGI  1195
              +  C CQ GY+     + C D VDEC      C   A+C +  G + C C  G+  +G+
Sbjct  1127  NTHHCRCQAGYT----GSYCEDLVDECSPSP--CQNGATCTDYLGGYSCKCVAGY--HGV  1178

Query  1196  KCI-DLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCS-DVDECAENVHLCE-  1252
              C  ++DEC   +H C     C++ P +Y C+C  G    G  C  +VD+C   V     
Sbjct  1179  NCSEEIDECL--SHPCQNGGTCLDLPNTYKCSCPRGT--QGVHCEINVDDCNPPVDPVSR  1234

Query  1253  ------NGQCLNVPGAYRCECEMGFTPASDSKSCQ-DINECSFQNICVFGTCNNLPGM--  1303
                   NG C++  G Y C C  GF      + C+ D+NEC        GT N +  +  
Sbjct  1235  SPKCFNNGTCVDQVGGYSCTCPPGFV----GERCEGDVNECLSNPCDARGTQNCVQRVND  1290

Query  1304  FHCICDDGYELDRTGGNCTDVDECADPINCVNG----LCVNTPGRYECNCPPDFQLNPTG  1359
             FHC C  G+    TG  C  V        C NG    +  NT   + C CP  F+    G
Sbjct  1291  FHCECRAGH----TGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFE----G  1342

Query  1360  VGCVDNRVGNCYLKYGPRGDGSLSC-NTEIGVGVSRSSCCCSLGK--------------A  1404
               C +N    C         GSL C N    +   RS  C  LG                
Sbjct  1343  ATC-ENDARTC---------GSLRCLNGGTCISGPRSPTCLCLGPFTGPECQFPASSPCL  1392

Query  1405  WGNPCE---TCPPVNSTE-YNTLCP---------------GGEGFRPNPITIILE--DID  1443
              GNPC    TC P + +  Y  LCP               GG   R  P  +I E  ++ 
Sbjct  1393  GGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDIPPPLIEEACELP  1452

Query  1444  ECQELPG  1450
             ECQE  G
Sbjct  1453  ECQEDAG  1459


 Score = 182 bits (462),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 355/1267 (28%), Positives = 509/1267 (40%), Gaps = 239/1267 (19%)

Query  863   KDINECKVFPGMCMNG-KCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGT  921
             +D+NEC   PG+C +G  C N +GS++C C +  T    ER          SP  C +G 
Sbjct  177   QDVNECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPC-----SPSPCQNGG  231

Query  922   CVNTPG--SFECECFDGYESGFMMMKNCMD-IDECERNPLLCRGGTCVNTEGSFQCDCPL  978
                  G  + EC C  G+       +NC + ID+C  N     GG CV+   ++ C CP 
Sbjct  232   TCRPTGDVTHECACLPGFTG-----QNCEENIDDCPGNNCK-NGGACVDGVNTYNCRCPP  285

Query  979   GHELSPSREECIDVNECSLSDSLCRNG-KCVNMVGTYQCSCNSGYQATPDRRSCTD-IDE  1036
                     E   DV+EC L  + C+NG  C N  G Y C C +G+        C++ ID+
Sbjct  286   EWTGQYCTE---DVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTG----EDCSENIDD  338

Query  1037  CMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIP--  1094
             C          C +   S+ C C  G   +     C   D C SNP   +G  C   P  
Sbjct  339   CASAACFHGATCHDRVASFYCECPHGRTGL----LCHLNDACISNP-CNEGSNCDTNPVN  393

Query  1095  GEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMF-GECENTKGSFICHCQLGYSVKKGT  1153
             G+  C C  G+      +   DV+EC L +N C   G+C NT GSF C C  GY+   G 
Sbjct  394   GKAICTCPSGYTGPACSQ---DVDECSLGANPCEHAGKCINTLGSFECQCLQGYT---GP  447

Query  1154  TGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIKC-IDLDECSNGTHQCSV  1212
                 DV+EC   ++ C   A+C++  G F+C C  G+   G+ C ++ DEC++    C  
Sbjct  448   RCEIDVNECV--SNPCQNDATCLDQIGEFQCICMPGY--EGVHCEVNTDECASSP--CLH  501

Query  1213  NAQCVNSPGSYLCACVEGFTGDGFTCSDVDECAENVHLCENG-QCLNVPGAYRCECEMGF  1271
             N +C++    + C C  GFTG      DVDECA     C+NG +CL+ P  Y C C  G+
Sbjct  502   NGRCLDKINEFQCECPTGFTGH-LCQYDVDECASTP--CKNGAKCLDGPNTYTCVCTEGY  558

Query  1272  TPASDSKSCQ-DINECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNC-TDVDECAD  1329
             T       C+ DI+EC   + C +G+C +    F C+C  GY    TG +C T+++EC+ 
Sbjct  559   T----GTHCEVDIDECD-PDPCHYGSCKDGVATFTCLCRPGY----TGHHCETNINECSS  609

Query  1330  PINCVNGLCVNTPGRYECNCP-----PDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSC  1384
                   G C +    Y C C      P+ ++N           G C  K     DG   C
Sbjct  610   QPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKI----DG-YEC  664

Query  1385  NTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNPITIILEDIDE  1444
               E   G + S C  ++ +  GNPC              C   EG+        L +++E
Sbjct  665   ACE--PGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHD---PTCLSEVNE  719

Query  1445  CQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLG  1504
             C   P  C  G C ++   ++C+C  G+     T    + +EC ++P V G GTC +   
Sbjct  720   CNSNP--CVHGACRDSLNGYKCDCDPGW---SGTNCDINNNECESNPCVNG-GTCKDMTS  773

Query  1505  NYTCICPPEYMQVNGGHNCMD------MRKSFCYRSYNGTSCENELPFNVTKRMCCCTYN  1558
              Y C C   +   N   N  +      + +  C     G  C   LP+  T   C     
Sbjct  774   GYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPY--TGATC-----  826

Query  1559  VGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKA-----VDIDECKEIPGICANG  1613
               +    PC P P     E +    +   F+    +G       VDI+EC   P  C +G
Sbjct  827   --EVVLAPCAPSPCRNGGECRQ-SEDYESFSCVCPTGWQGQTCEVDINECVLSP--CRHG  881

Query  1614  V-CINQIGSFRCECPTGFS-------------------------YNDLLLVC--------  1639
               C N  G +RC C  G+S                          N     C        
Sbjct  882   ASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTF  941

Query  1640  --EDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRN--ECLEIPNVCS  1695
               EDI+EC++  + C+  A+C +   SY C C AGF    +G   + N  +C E  +  +
Sbjct  942   CEEDINECAS--DPCRNGANCTDCVDSYTCTCPAGF----SGIHCENNTPDCTES-SCFN  994

Query  1696  HGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPCGNG-TCKNTVGSYNCLCYPGF  1754
              G CVD   S+ C+C  GF  S  Q    DV+EC+  PC +G TC++  GSY C C  G+
Sbjct  995   GGTCVDGINSFTCLCPPGFTGSYCQ---HDVNECDSQPCLHGGTCQDGCGSYRCTCPQGY  1051

Query  1755  ELTHNNDCMDIDECSSFFGQVCRNG-RCFNEIGSFKCLCNEGY-----------------  1796
               T  N    +  C S     C+NG +C+     ++C C  G+                 
Sbjct  1052  --TGPNCQNLVHWCDS---SPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQ  1106

Query  1797  -------ELTLDGKNCIDT--------------NECVALPGSCSPGTCQN------LEGS  1829
                     L   G  C+D               + C  L   CSP  CQN        G 
Sbjct  1107  RQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGG  1166

Query  1830  FRCICPPGYEVKSESCIDINECNEDPNICLFG-SCTNTPGGFQCICPTGF------VLSD  1882
             + C C  GY   + S  +I+EC   P  C  G +C + P  ++C CP G       +  D
Sbjct  1167  YSCKCVAGYHGVNCS-EEIDECLSHP--CQNGGTCLDLPNTYKCSCPRGTQGVHCEINVD  1223

Query  1883  NGRRCFD--TRQSFCFTN------FENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELC  1934
             +     D  +R   CF N           C+ P  F   +    C     E   +PC+  
Sbjct  1224  DCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGER----CEGDVNECLSNPCDAR  1279

Query  1935  PKEEEVA----FQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNGH----CINTDGSFR  1986
               +  V     F   C  GH            +N C   P  C NG       NT   F 
Sbjct  1280  GTQNCVQRVNDFHCECRAGHTG----RRCESVINGCKGKP--CKNGGTCAVASNTARGFI  1333

Query  1987  CECPMGY  1993
             C+CP G+
Sbjct  1334  CKCPAGF  1340


 Score = 145 bits (366),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 259/920 (28%), Positives = 372/920 (40%), Gaps = 190/920 (21%)

Query  278   GLTILNQTIDICKHHPDLCLNGRCIPTLSSYRCECNMGYKQD---------------SNG  322
             G T  +  +DI +  PD C  G C   ++++ C C  GY                    G
Sbjct  557   GYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGG  616

Query  323   DCTD---------------------VDECTSNPCSNGDCVNTPGSYYCKCHAGFQRTPTK  361
              C D                     +D+C S+PC +G C++    Y C C  G+    T 
Sbjct  617   TCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKIDGYECACEPGY----TG  672

Query  362   QAC-IDIDECIQNGVLCKN-GRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCL  419
               C I+IDEC  N   C N G C +    F C C  G+   T    C+       +N C+
Sbjct  673   SMCNINIDECAGNP--CHNGGTCEDGINGFTCRCPEGYHDPT----CLSEVNECNSNPCV  726

Query  420   NGMCINEDGSFKCICKPGFVLAPNGRYC-TDIDECQTSGICMNGHCINTEGSFRCECPPG  478
             +G C +    +KC C PG+    +G  C  + +EC+++     G C +    + C C  G
Sbjct  727   HGACRDSLNGYKCDCDPGW----SGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREG  782

Query  479   LAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYG-----FGEPCH  533
              + G + +  ++    + C   + +G C+    G     +C C  P  G        PC 
Sbjct  783   FS-GPNCQTNINECASNPC---LNQGTCIDDVAGY----KCNCLLPYTGATCEVVLAPCA  834

Query  534   PCPAKNSAE---------FHGLCSSGIGITVDGRDINECALDPDICSNGI-CENLRGSYR  583
             P P +N  E         F  +C +G        DINEC L P  C +G  C+N  G YR
Sbjct  835   PSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSP--CRHGASCQNTHGGYR  892

Query  584   CNCNSGYEPDPSGRNC-VDIDECSVNRLLCDN-GLCRNTPGSYSCTCPKGYVFSTETDTC  641
             C+C +GY    SGRNC  DID+C  N   C N G C +   +  C C  G+     T   
Sbjct  893   CHCQAGY----SGRNCETDIDDCRPNP--CHNGGSCTDGINTAFCDCLPGF---RGTFCE  943

Query  642   EDINECESSPCVNGA-CRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEV  700
             EDINEC S PC NGA C + + S+ C C  G     +G+ C ++       +  +S C  
Sbjct  944   EDINECASDPCRNGANCTDCVDSYTCTCPAG----FSGIHCENNTP-----DCTESSC--  992

Query  701   NINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVNGVTCE-DVNECDVFPGVCPN  759
               NG T    C   + +              C  GF    G  C+ DVNECD  P +   
Sbjct  993   -FNGGT----CVDGINS----------FTCLCPPGFT---GSYCQHDVNECDSQPCL-HG  1033

Query  760   GRCINSRGSFHCECPEGLTLDGTGRVCLDIRME----------QCYLTWDED--ECIRSV  807
             G C +  GS+ C CP+G     TG  C ++             +C+ T  +   EC    
Sbjct  1034  GTCQDGCGSYRCTCPQGY----TGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGW  1089

Query  808   PGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDI--------LTGR  859
              G +      C V +     CE   +    +   LC  G    + G+          TG 
Sbjct  1090  TGLY------CDVPSV---SCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGS  1140

Query  860   PFYKDINECKVFPGMCMNGK-CRNTIGSFKCKCNSGFTLDMEERNCT-DIDECWISPDLC  917
                  ++EC   P  C NG  C + +G + CKC +G+       NC+ +IDEC   P   
Sbjct  1141  YCEDLVDECS--PSPCQNGATCTDYLGGYSCKCVAGY----HGVNCSEEIDECLSHPCQN  1194

Query  918   GSGTCVNTPGSFECECFDGYESGFMMMKNCMD----IDECERNPLLCRGGTCVNTEGSFQ  973
             G GTC++ P +++C C  G + G     N  D    +D   R+P     GTCV+  G + 
Sbjct  1195  G-GTCLDLPNTYKCSCPRGTQ-GVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYS  1252

Query  974   CDCPLGHELSPSREECI-DVNECSLSDSLCRNGK-CVNMVGTYQCSCNSGYQATPDRRSC  1031
             C CP G       E C  DVNEC  +    R  + CV  V  + C C +G+     RR  
Sbjct  1253  CTCPPGF----VGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTG---RRCE  1305

Query  1032  TDIDECM---IMNGGCHTHCTNSEGSYECSCSDGYALMP---DVRTCADIDECESNPDIC  1085
             + I+ C      NGG     +N+   + C C  G+       D RTC  +          
Sbjct  1306  SVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCGSL-------RCL  1358

Query  1086  DGGQCTNIPGEYRCLCYDGF  1105
             +GG C + P    CLC   F
Sbjct  1359  NGGTCISGPRSPTCLCLGPF  1378


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 61/134 (46%), Gaps = 11/134 (8%)

Query  66   QDVDECQAIPGVCQ-GGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICEGSE  124
            +DVDECQ +P  CQ GG C NT G Y C C  G    + ++  DD    +       G+ 
Sbjct  294  EDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACF----HGAT  349

Query  125  CSNTVGSYFCICPRGY--VTSTDGSRCID---QRASTCFSNIVNGRCAQELPGRFTKRQC  179
            C + V S++C CP G   +       CI       S C +N VNG+     P  +T   C
Sbjct  350  CHDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPAC  409

Query  180  CCESGRCWAMGSVP  193
              +   C ++G+ P
Sbjct  410  SQDVDEC-SLGANP  422


> sp|Q9UM47|NOTC3_HUMAN Neurogenic locus notch homolog protein 
3 OS=Homo sapiens GN=NOTCH3 PE=1 SV=2
Length=2321

 Score = 225 bits (574),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 375/1370 (27%), Positives = 534/1370 (39%), Gaps = 261/1370 (19%)

Query  580   GSYRCNCNSGYEPDPSGRNC-VDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTET  638
             G + C+C  GY+    GR+C  D+DEC V       G C NTPGS+ C CP GY      
Sbjct  140   GRFLCSCPPGYQ----GRSCRSDVDECRVGEPCRHGGTCLNTPGSFRCQCPAGYT----G  191

Query  639   DTCED-INECESSPCVNGACRNNLG--SFNCECSPGSKLDSTGLICIDSLKGTCWLNIQD  695
               CE+    C  SPC NG      G  +++C C PG                      + 
Sbjct  192   PLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPG---------------------FEG  230

Query  696   SRCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVN--------GVTC-ED  746
               CEVN++      +C          P  RC     C  G    N        G  C ED
Sbjct  231   QNCEVNVD------DC----------PGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTED  274

Query  747   VNECDVFPGVCPN-GRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIR  805
             V+EC + P  C N G C N+ G   C C  G T +   +   D     C+      + + 
Sbjct  275   VDECQLQPNACHNGGTCFNTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVA  334

Query  806   SVPGKFRMDACCCAVG----------AAWGSDCEECPKPDTKEY--EALCPRGPGFSNRG  853
             S         C C +G          A   + C E    DT      A+C   PGF    
Sbjct  335   SF-------YCACPMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGF----  383

Query  854   DILTGRPFYKDINECKVFPGMCMN-GKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWI  912
                TG    +D++EC +    C + G+C NT GSF C+C  G+T    E   TD++EC  
Sbjct  384   ---TGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCE---TDVNECLS  437

Query  913   SPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSF  972
              P      TC++  G F C C  G+   +      +DIDEC+ +P +  GG C +    F
Sbjct  438   GP-CRNQATCLDRIGQFTCICMAGFTGTYCE----VDIDECQSSPCV-NGGVCKDRVNGF  491

Query  973   QCDCPLGHELSPSREECIDVNECSLSDSLCRNG-KCVNMVGTYQCSCNSGYQATPDRRSC  1031
              C CP G   S  +   +DV+EC  + + CRNG KCV+    Y+C C  G++ T   R+ 
Sbjct  492   SCTCPSGFSGSTCQ---LDVDEC--ASTPCRNGAKCVDQPDGYECRCAEGFEGTLCDRNV  546

Query  1032  TD--IDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQ  1089
              D   D C       H  C +   S+ C+C+ GY      R  + +DEC S P    GG+
Sbjct  547   DDCSPDPCH------HGRCVDGIASFSCACAPGYT---GTRCESQVDECRSQP-CRHGGK  596

Query  1090  CTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSV  1149
             C ++  +Y C C  G           +VN  D  SN C FG C +    + C CQ G++ 
Sbjct  597   CLDLVDKYLCRCPSGTTGVN-----CEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFT-  650

Query  1150  KKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQ  1209
               G     +++EC   +  C    SCV+    F+C C  G     +  + L       H+
Sbjct  651   --GPLCNVEINEC--ASSPCGEGGSCVDGENGFRCLCPPG----SLPPLCLPPSHPCAHE  702

Query  1210  CSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECAENVHLCENGQCLNVPGAYRCECEM  1269
                +  C ++PG + C C  G++G   + S   +  E+      G C +    + C C  
Sbjct  703   PCSHGICYDAPGGFRCVCEPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTC--  760

Query  1270  GFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFH-CICDDGYELDRTGGNCTDVDECA  1328
                P    + C+ ++ C+       G C + PG    C C  G++  R      DVDECA
Sbjct  761   --PPGVQGRQCELLSPCTPNPCEHGGRCESAPGQLPVCSCPQGWQGPRCQ---QDVDECA  815

Query  1329  DPINC-VNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCY----LKYGP--RGDGS  1381
              P  C  +G+C N  G + C C   +    TG  C D  + +C     L  G    G GS
Sbjct  816   GPAPCGPHGICTNLAGSFSCTCHGGY----TGPSC-DQDINDCDPNPCLNGGSCQDGVGS  870

Query  1382  LSCNTEIGVGVSRSSCCCSLGKAWGNPC--ETCPPVNSTEYNTLCPGGEGFRPNPITIIL  1439
              SC+   G    R  C   + +   NPC   TC    ++   T  PG  GF         
Sbjct  871   FSCSCLPGFAGPR--CARDVDECLSNPCGPGTCTDHVASFTCTCPPGYGGFH------CE  922

Query  1440  EDIDECQELPGLC-QGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGT  1498
             +D+ +C   P  C  GG C++   SF C C  GY  +       + D C++ P + G G 
Sbjct  923   QDLPDCS--PSSCFNGGTCVDGVNSFSCLCRPGYTGAH---CQHEADPCLSRPCLHG-GV  976

Query  1499  CYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRS--YNGTSCENE-----LPFNVTKR  1551
             C      + C C    ++   G  C  +   +C R    NG  C         P   + R
Sbjct  977   CSAAHPGFRCTC----LESFTGPQCQTL-VDWCSRQPCQNGGRCVQTGAYCLCPPGWSGR  1031

Query  1552  MCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICA  1611
             +C          + PC           + +C                            A
Sbjct  1032  LC-------DIRSLPCREAAAQIGVRLEQLCQ---------------------------A  1057

Query  1612  NGVCINQIGSFRCECPTGFSYNDLLLVCE-DIDECSNGDNLCQRNADCINSPGSYRCECA  1670
              G C+++  S  C CP G + +     CE ++D C      CQ    C    G Y CEC 
Sbjct  1058  GGQCVDEDSSHYCVCPEGRTGSH----CEQEVDPCLA--QPCQHGGTCRGYMGGYMCECL  1111

Query  1671  AGFKLSPNGACVDRNECLEIPNVCSH-GLCVDMQGSYKCICHNGFKASQDQTMC-MDVDE  1728
              G+    +    D +EC   P  C H G C+D+   Y C C  G        +C ++ D+
Sbjct  1112  PGYNG--DNCEDDVDECASQP--CQHGGSCIDLVARYLCSCPPGTLG----VLCEINEDD  1163

Query  1729  CERHP--------CGNGTCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSFFGQVCRNGR  1780
             C   P          NGTC + VG + C C PG+         DI+EC S          
Sbjct  1164  CGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGLRCE--ADINECRSGACHAAHTRD  1221

Query  1781  CFNEI-GSFKCLCNEGYELTLDGKNCIDT-NECVALP----GSCSPGTCQNLEGSFRCIC  1834
             C  +  G F+CLC+ G+     G  C    + C + P    G C P        +F C C
Sbjct  1222  CLQDPGGGFRCLCHAGFS----GPRCQTVLSPCESQPCQHGGQCRPSPGPGGGLTFTCHC  1277

Query  1835  P-----PGYEVKSESCIDINECNEDPNICLFG-SCTNTPGGFQCICPTGF  1878
                   P  E  + SC ++         C  G  C  TP G +C CP G 
Sbjct  1278  AQPFWGPRCERVARSCRELQ--------CPVGVPCQQTPRGPRCACPPGL  1319


 Score = 212 bits (539),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 342/1259 (27%), Positives = 506/1259 (40%), Gaps = 211/1259 (17%)

Query  877   NGKCRNTI----GSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECE  932
              G C++++      F C+C  GF       +C+  D C  SP   G+   V   G F C 
Sbjct  90    RGVCQSSVVAGTARFSCRCPRGF----RGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCS  145

Query  933   CFDGYESGFMMMKNCM-DIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECID  991
             C  GY+      ++C  D+DEC        GGTC+NT GSF+C CP G+         + 
Sbjct  146   CPPGYQG-----RSCRSDVDECRVGEPCRHGGTCLNTPGSFRCQCPAGYTGPLCENPAVP  200

Query  992   VNECSLSDSLCRNGKCVNMVG--TYQCSCNSGYQATPDRRSC-TDIDEC---MIMNGGCH  1045
                   + S CRNG      G  TY C+C  G++     ++C  ++D+C     +NGG  
Sbjct  201   C-----APSPCRNGGTCRQSGDLTYDCACLPGFEG----QNCEVNVDDCPGHRCLNGG--  249

Query  1046  THCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDIC-DGGQCTNIPGEYRCLCYDG  1104
               C +   +Y C C   +          D+DEC+  P+ C +GG C N  G + C+C +G
Sbjct  250   -TCVDGVNTYNCQCPPEWT---GQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCVCVNG  305

Query  1105  FMASMDMKTCIDVNECDLNSNICMFGE-CENTKGSFICHCQLGYS---------------  1148
             +      ++C   N  D  + +C  G  C +   SF C C +G +               
Sbjct  306   WTG----ESCSQ-NIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPC  360

Query  1149  ---------VKKGTTGCT------------DVDECEIGAHNCDMHASCVNVPGSFKCSCR  1187
                         G   CT            DVDEC IGA+ C+    CVN  GSF C C 
Sbjct  361   HEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCG  420

Query  1188  EGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECAEN  1247
              G+ G   +  D++EC +G   C   A C++  G + C C+ GFTG  +   D+DEC ++
Sbjct  421   RGYTGPRCE-TDVNECLSGP--CRNQATCLDRIGQFTCICMAGFTGT-YCEVDIDEC-QS  475

Query  1248  VHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQ-DINECSFQNICVFGTCNNLPGMFHC  1306
                   G C +    + C C  GF+      +CQ D++EC+         C + P  + C
Sbjct  476   SPCVNGGVCKDRVNGFSCTCPSGFS----GSTCQLDVDECASTPCRNGAKCVDQPDGYEC  531

Query  1307  ICDDGYELDRTGGNC-TDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDN  1365
              C +G+E    G  C  +VD+C+ P  C +G CV+    + C C P +    TG  C ++
Sbjct  532   RCAEGFE----GTLCDRNVDDCS-PDPCHHGRCVDGIASFSCACAPGY----TGTRC-ES  581

Query  1366  RVGNCYLKYGPRGDGSLSCNTEI----GVGVSRSSCCCSLGKAWGNPCETCPPVNST-EY  1420
             +V  C  +    G   L    +       G +  +C  ++     NPC      +    Y
Sbjct  582   QVDECRSQPCRHGGKCLDLVDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRY  641

Query  1421  NTLC-PGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETR  1479
             + +C PG  G    P+  +  +I+EC   P   +GG+C++    F+C CP G        
Sbjct  642   DCVCQPGFTG----PLCNV--EINECASSP-CGEGGSCVDGENGFRCLCPPGSL----PP  690

Query  1480  ICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRS---YN  1536
             +C       AH   C  G CY+  G + C+C P +   +G      + +  C        
Sbjct  691   LCLPPSHPCAH-EPCSHGICYDAPGGFRCVCEPGW---SGPRCSQSLARDACESQPCRAG  746

Query  1537  GTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGK  1596
             GT   + + F+     C C   V     +   PC TP   E    C + PG        +
Sbjct  747   GTCSSDGMGFH-----CTCPPGVQGRQCELLSPC-TPNPCEHGGRCESAPGQLPVCSCPQ  800

Query  1597  AV-------DIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGD  1649
                      D+DEC        +G+C N  GSF C C  G++        +DI++C    
Sbjct  801   GWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGGYTGPSCD---QDINDCD--P  855

Query  1650  NLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDMQGSYKCI  1709
             N C     C +  GS+ C C  GF   P  A  D +ECL   N C  G C D   S+ C 
Sbjct  856   NPCLNGGSCQDGVGSFSCSCLPGFA-GPRCA-RDVDECLS--NPCGPGTCTDHVASFTCT  911

Query  1710  CHNGFKASQDQTMCMDVDECERHPCGN-GTCKNTVGSYNCLCYPGFELTHNNDCMDIDEC  1768
             C  G+     +    D+ +C    C N GTC + V S++CLC PG+   H     + D C
Sbjct  912   CPPGYGGFHCE---QDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQ--HEADPC  966

Query  1769  SSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQN---  1825
              S        G C      F+C C E +             +C  L   CS   CQN   
Sbjct  967   LSR--PCLHGGVCSAAHPGFRCTCLESFT----------GPQCQTLVDWCSRQPCQNGGR  1014

Query  1826  -LEGSFRCICPPGY-----EVKS----ESCIDINECNEDPNICLF-GSCTNTPGGFQCIC  1874
              ++    C+CPPG+     +++S    E+   I    E   +C   G C +      C+C
Sbjct  1015  CVQTGAYCLCPPGWSGRLCDIRSLPCREAAAQIGVRLE--QLCQAGGQCVDEDSSHYCVC  1072

Query  1875  PTGFVLSDNGRRCFDTRQSFCFTNFENG----------KCSVPKAFNTTKAKCCCSKMPG  1924
             P G      G  C            ++G           C     +N       C     
Sbjct  1073  PEG----RTGSHCEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGDN----CEDDVD  1124

Query  1925  EGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTRED---VNECLES-PGVCSNGHCIN  1980
             E    PC+      ++  + LC    GT+  + +  ED       L+S P    NG C++
Sbjct  1125  ECASQPCQHGGSCIDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVD  1184

Query  1981  TDGSFRCECPMGYNLDYTGVHC-IDTDECSIGNPCGNGTCTNVI----GSFECNCHEGF  2034
               G FRC CP G    YTG+ C  D +EC  G  C      + +    G F C CH GF
Sbjct  1185  LVGGFRCTCPPG----YTGLRCEADINECRSGA-CHAAHTRDCLQDPGGGFRCLCHAGF  1238


 Score = 201 bits (510),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 333/1185 (28%), Positives = 468/1185 (39%), Gaps = 275/1185 (23%)

Query  306   SSYRCECNMGYKQDSNGDCTDVDECTSNPCSNGD--CVNTPGSYYCKCHAGFQRTPTKQA  363
             + + C C  G++     DC+  D C S+PC++G    V   G + C C  G+Q    +  
Sbjct  102   ARFSCRCPRGFR---GPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRS-  157

Query  364   CIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGF--------------------------  397
               D+DEC         G C+NT GSF+C C AG+                          
Sbjct  158   --DVDECRVGEPCRHGGTCLNTPGSFRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQS  215

Query  398   -ELTTD--------GKNC-VDHDECTTTNMCLN-GMCINEDGSFKCICKPGFVLAPNGRY  446
              +LT D        G+NC V+ D+C   + CLN G C++   ++ C C P +     G++
Sbjct  216   GDLTYDCACLPGFEGQNCEVNVDDC-PGHRCLNGGTCVDGVNTYNCQCPPEWT----GQF  270

Query  447   CT-DIDECQTS-GICMN-GHCINTEGSFRCECPPGLAVGVDGRVC---VDTHMRSTCYGG  500
             CT D+DECQ     C N G C NT G   C C      G  G  C   +D    + C+ G
Sbjct  271   CTEDVDECQLQPNACHNGGTCFNTLGGHSCVC----VNGWTGESCSQNIDDCATAVCFHG  326

Query  501   IKKGACVRPFPGA--VTKSECCCANPDYGFGEPCHPCPA--KNSAEFHGLCSSGIGITVD  556
                   V  F  A  + K+   C   D     PCH       N      +C+   G T  
Sbjct  327   ATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGG  386

Query  557   G--RDINECALDPDICSN-GICENLRGSYRCNCNSGYEPDPSGRNC-VDIDECSVNRLLC  612
                +D++EC++  + C + G C N +GS+ C C  GY    +G  C  D++EC ++    
Sbjct  387   ACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGRGY----TGPRCETDVNEC-LSGPCR  441

Query  613   DNGLCRNTPGSYSCTCPKGYVFSTETDTCE-DINECESSPCVN-GACRNNLGSFNCECSP  670
             +   C +  G ++C C  G+  +     CE DI+EC+SSPCVN G C++ +  F+C C  
Sbjct  442   NQATCLDRIGQFTCICMAGFTGT----YCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPS  497

Query  671   GSKLDSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDT  730
             G                TC L++ +       NGA    +         G  C       
Sbjct  498   GFS------------GSTCQLDVDECASTPCRNGAKCVDQ-------PDGYECR------  532

Query  731   ACSRGFARVNGVTCEDVNECDVFPGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIR  790
              C+ GF    G  C D N  D  P  C +GRC++   SF C C  G T           R
Sbjct  533   -CAEGF---EGTLC-DRNVDDCSPDPCHHGRCVDGIASFSCACAPGYT---------GTR  578

Query  791   MEQCYLTWDEDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFS  850
              E        DEC RS P +              G  C +       +Y   CP G    
Sbjct  579   CES-----QVDEC-RSQPCRH-------------GGKCLDL----VDKYLCRCPSG----  611

Query  851   NRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDEC  910
                   TG     +I++C   P  C  G CR+ I  + C C  GFT  +      +I+EC
Sbjct  612   -----TTGVNCEVNIDDCASNP--CTFGVCRDGINRYDCVCQPGFTGPLCN---VEINEC  661

Query  911   WISP------------------------------------DLCGSGTCVNTPGSFECECF  934
               SP                                    + C  G C + PG F C C 
Sbjct  662   ASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCSHGICYDAPGGFRCVCE  721

Query  935   DGYESGFMMMKNCMDIDECERNPLLCR-GGTCVNTEGSFQCDCPLGHE------LSP---  984
              G+ SG    ++ +  D CE  P  CR GGTC +    F C CP G +      LSP   
Sbjct  722   PGW-SGPRCSQS-LARDACESQP--CRAGGTCSSDGMGFHCTCPPGVQGRQCELLSPCTP  777

Query  985   ------SREECI--------------------DVNECSLSDSLCRNGKCVNMVGTYQCSC  1018
                    R E                      DV+EC+       +G C N+ G++ C+C
Sbjct  778   NPCEHGGRCESAPGQLPVCSCPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTC  837

Query  1019  NSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDEC  1078
             + GY      +   D D    +NGG    C +  GS+ CSC  G+A     R   D+DEC
Sbjct  838   HGGYTGPSCDQDINDCDPNPCLNGG---SCQDGVGSFSCSCLPGFA---GPRCARDVDEC  891

Query  1079  ESNPDICDGGQCTNIPGEYRCLC---YDGFMASMDMKTCIDVNECDLNSNICMFGECENT  1135
              SNP  C  G CT+    + C C   Y GF    D+  C         S+    G C + 
Sbjct  892   LSNP--CGPGTCTDHVASFTCTCPPGYGGFHCEQDLPDCSP-------SSCFNGGTCVDG  942

Query  1136  KGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGI  1195
               SF C C+ GY+   G     + D C   +  C     C      F+C+C E + G   
Sbjct  943   VNSFSCLCRPGYT---GAHCQHEADPCL--SRPCLHGGVCSAAHPGFRCTCLESFTGPQC  997

Query  1196  KCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGD--GFTCSDVDECAENV-----  1248
             + + +D CS     C    +CV + G+Y C C  G++G           E A  +     
Sbjct  998   QTL-VDWCSR--QPCQNGGRCVQT-GAY-CLCPPGWSGRLCDIRSLPCREAAAQIGVRLE  1052

Query  1249  HLCE-NGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCI  1307
              LC+  GQC++   ++ C C  G T    S   Q+++ C  Q     GTC    G + C 
Sbjct  1053  QLCQAGGQCVDEDSSHYCVCPEGRT---GSHCEQEVDPCLAQPCQHGGTCRGYMGGYMCE  1109

Query  1308  CDDGYELDRTGGNCT-DVDECADPINCVNGLCVNTPGRYECNCPP  1351
             C  GY     G NC  DVDECA       G C++   RY C+CPP
Sbjct  1110  CLPGY----NGDNCEDDVDECASQPCQHGGSCIDLVARYLCSCPP  1150


 Score = 150 bits (379),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 267/978 (27%), Positives = 380/978 (39%), Gaps = 213/978 (22%)

Query  280   TILNQTIDICKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNGDC-TDVDECTSNPCSN-  337
             T+ ++ +D C   PD C +GRC+  ++S+ C C  GY   +   C + VDEC S PC + 
Sbjct  540   TLCDRNVDDCS--PDPCHHGRCVDGIASFSCACAPGY---TGTRCESQVDECRSQPCRHG  594

Query  338   GDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGF  397
             G C++    Y C+C +G   T      ++ID+C  N   C  G C +    + C+C  GF
Sbjct  595   GKCLDLVDKYLCRCPSG---TTGVNCEVNIDDCASN--PCTFGVCRDGINRYDCVCQPGF  649

Query  398   ELTTDGKNC-VDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTS  456
                  G  C V+ +EC ++     G C++ +  F+C+C PG  L P    C         
Sbjct  650   T----GPLCNVEINECASSPCGEGGSCVDGENGFRCLCPPG-SLPP---LCLPPSHPCAH  701

Query  457   GICMNGHCINTEGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGGI--KKGACVRPF----  510
               C +G C +  G FRC C PG +    G  C  +  R  C        G C        
Sbjct  702   EPCSHGICYDAPGGFRCVCEPGWS----GPRCSQSLARDACESQPCRAGGTCSSDGMGFH  757

Query  511   ---PGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGLCSSGIGITVD-----------  556
                P  V   +C           PC P    N  E  G C S  G               
Sbjct  758   CTCPPGVQGRQC-------ELLSPCTP----NPCEHGGRCESAPGQLPVCSCPQGWQGPR  806

Query  557   -GRDINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNC-VDIDECSVNRLLCDN  614
               +D++ECA       +GIC NL GS+ C C+ GY    +G +C  DI++C  N  L + 
Sbjct  807   CQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGGY----TGPSCDQDINDCDPNPCL-NG  861

Query  615   GLCRNTPGSYSCTCPKGYVFSTETDTCEDINECESSPCVNGACRNNLGSFNCECSPGSKL  674
             G C++  GS+SC+C  G+          D++EC S+PC  G C +++ SF C C PG   
Sbjct  862   GSCQDGVGSFSCSCLPGFAGPR---CARDVDECLSNPCGPGTCTDHVASFTCTCPPGYG-  917

Query  675   DSTGLICIDSLK----------GTCW--LNIQDSRCEVNINGATLKSECCATLGAAWGSP  722
                G  C   L           GTC   +N     C     GA  + E    L      P
Sbjct  918   ---GFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQHEADPCL----SRP  970

Query  723   CERCELDTACSRGF-----ARVNGVTCED-VNECDVFPGVCPN-GRCINSRGSFHCECPE  775
             C    + +A   GF         G  C+  V+ C   P  C N GRC+ +    +C CP 
Sbjct  971   CLHGGVCSAAHPGFRCTCLESFTGPQCQTLVDWCSRQP--CQNGGRCVQT--GAYCLCPP  1026

Query  776   GLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKPD  835
             G     +GR+C DIR   C       E    +    R++  C A G        +C   D
Sbjct  1027  GW----SGRLC-DIRSLPCR------EAAAQI--GVRLEQLCQAGG--------QCVDED  1065

Query  836   TKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGF  895
             +  Y  +CP G          TG    ++++ C   P     G CR  +G + C+C  G+
Sbjct  1066  SSHY-CVCPEG---------RTGSHCEQEVDPCLAQPCQ-HGGTCRGYMGGYMCECLPGY  1114

Query  896   TLDMEERNCT-DIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECE  954
               D    NC  D+DEC   P   G G+C++    + C C      G + +   ++ D+C 
Sbjct  1115  NGD----NCEDDVDECASQPCQHG-GSCIDLVARYLCSC----PPGTLGVLCEINEDDCG  1165

Query  955   RNPLLCRG------GTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCV  1008
               P L  G      GTCV+  G F+C CP G+  +  R E  D+NE       CR+G C 
Sbjct  1166  PGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGY--TGLRCE-ADINE-------CRSGAC-  1214

Query  1009  NMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPD  1068
             +   T  C  + G                               G + C C  G++    
Sbjct  1215  HAAHTRDCLQDPG-------------------------------GGFRCLCHAGFS---G  1240

Query  1069  VRTCADIDECESNPDICDGGQCTNIPGE-----YRCLCYDGFMASMDMKTCIDVNECDLN  1123
              R    +  CES P    GGQC   PG      + C C   F      +      E    
Sbjct  1241  PRCQTVLSPCESQP-CQHGGQCRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCP  1299

Query  1124  SNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHN-------CDMHASCV  1176
               +     C+ T     C C  G S       C        GA N       C    SC 
Sbjct  1300  VGV----PCQQTPRGPRCACPPGLSGPS----CRSFPGSPPGASNASCAAAPCLHGGSCR  1351

Query  1177  NVPGS--FKCSCREGWVG  1192
               P +  F+C+C +GW G
Sbjct  1352  PAPLAPFFRCACAQGWTG  1369


 Score = 50.4 bits (119),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 57/121 (47%), Gaps = 12/121 (10%)

Query  66   QDVDECQAIPGVCQ-GGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGIC-EGS  123
            +DVDECQ  P  C  GG C NT+G + C C  G      +Q   +ID+C+    +C  G+
Sbjct  273  EDVDECQLQPNACHNGGTCFNTLGGHSCVCVNGWTGESCSQ---NIDDCAT--AVCFHGA  327

Query  124  ECSNTVGSYFCICPRGY--VTSTDGSRCID---QRASTCFSNIVNGRCAQELPGRFTKRQ  178
             C + V S++C CP G   +       C+       + C +N VNGR     P  FT   
Sbjct  328  TCHDRVASFYCACPMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGA  387

Query  179  C  179
            C
Sbjct  388  C  388


> sp|P98095|FBLN2_HUMAN Fibulin-2 OS=Homo sapiens GN=FBLN2 PE=1 
SV=2
Length=1184

 Score = 199 bits (507),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 156/440 (35%), Positives = 215/440 (49%), Gaps = 47/440 (11%)

Query  1482  EDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCM--------DMRKSFCYR  1533
             +D DEC+  PG      C NT+G+Y C C P +   + G  C         +  +    +
Sbjct  603   DDQDECLLLPGELCQHLCINTVGSYHCACFPGFSLQDDGRTCRPEGHPPQPEAPQEPALK  662

Query  1534  SYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPC-EPCPTPGTAEFKNICGNIPGFTFDI  1592
             S       N +P  + +   C         N PC + C T G +    IC   PG+    
Sbjct  663   SEFSQVASNTIPLPLPQPNTC-------KDNGPCKQVCSTVGGSA---ICSCFPGYAIMA  712

Query  1593  HSGKAVDIDECKEIPGICANGV-CINQIGSFRC----ECPTGFSYNDLLLVCEDIDECSN  1647
                   DI+EC      C+ G  C+N +GSF C     C  G++  D    CED+DEC+ 
Sbjct  713   DGVSCEDINECVTDLHTCSRGEHCVNTLGSFHCYKALTCEPGYALKD--GECEDVDECAM  770

Query  1648  GDNLCQRNADCINSPGSYRCE----CAAGFKLSPNGACVDRNECLEIPNVCSHGL-CVDM  1702
             G + CQ    C N+ GS+ C+    C  GF   P G CVD NEC  +   C  G  C++ 
Sbjct  771   GTHTCQPGFLCQNTKGSFYCQARQRCMDGFLQDPEGNCVDINECTSLSEPCRPGFSCINT  830

Query  1703  QGSYKC-----ICHNGFKASQDQTMCMDVDECER--HPCGNG-TCKNTVGSYNCLCYPGF  1754
              GSY C     IC  G+ AS D T C+DV+ECE   H CG G  C N  GSY C C  GF
Sbjct  831   VGSYTCQRNPLICARGYHASDDGTKCVDVNECETGVHRCGEGQVCHNLPGSYRCDCKAGF  890

Query  1755  EL-THNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVA  1813
             +       C+D++EC +  G++C++  C N +GS++C C  G+ L  DGK C D NEC A
Sbjct  891   QRDAFGRGCIDVNECWASPGRLCQH-TCENTLGSYRCSCASGFLLAADGKRCEDVNECEA  949

Query  1814  LPGSCSPGTCQNLEGSFRCICPPGYEVKSE--SCIDINECNEDPNICLFGSCTNTPGGFQ  1871
                 CS   C N+ GS++C C  GY++  +  +C DI+EC +   I     C N PG +Q
Sbjct  950   --QRCS-QECANIYGSYQCYCRQGYQLAEDGHTCTDIDECAQGAGILCTFRCLNVPGSYQ  1006

Query  1872  CICP-TGFVLSDNGRRCFDT  1890
             C CP  G+ ++ NGR C D 
Sbjct  1007  CACPEQGYTMTANGRSCKDV  1026


 Score = 182 bits (462),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 162/477 (34%), Positives = 215/477 (45%), Gaps = 49/477 (10%)

Query  906   DIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTC  965
             D DEC + P       C+NT GS+ C CF G+    +         E             
Sbjct  604   DQDECLLLPGELCQHLCINTVGSYHCACFPGFS---LQDDGRTCRPEGHPPQPEAPQEPA  660

Query  966   VNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQAT  1025
             + +E S      +   L P    C D   C           C  + G+  CSC  GY   
Sbjct  661   LKSEFSQVASNTIPLPL-PQPNTCKDNGPC--------KQVCSTVGGSAICSCFPGYAIM  711

Query  1026  PDRRSCTDIDECMIMNGGCHT--HCTNSEGSYEC----SCSDGYALMPDVRTCADIDECE  1079
              D  SC DI+EC+     C    HC N+ GS+ C    +C  GYAL      C D+DEC 
Sbjct  712   ADGVSCEDINECVTDLHTCSRGEHCVNTLGSFHCYKALTCEPGYALKDG--ECEDVDECA  769

Query  1080  SNPDICDGG-QCTNIPGEYRC----LCYDGFMASMDMKTCIDVNECDLNSNICMFG-ECE  1133
                  C  G  C N  G + C     C DGF+   +   C+D+NEC   S  C  G  C 
Sbjct  770   MGTHTCQPGFLCQNTKGSFYCQARQRCMDGFLQDPE-GNCVDINECTSLSEPCRPGFSCI  828

Query  1134  NTKGSFICH-----CQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCRE  1188
             NT GS+ C      C  GY      T C DV+ECE G H C     C N+PGS++C C+ 
Sbjct  829   NTVGSYTCQRNPLICARGYHASDDGTKCVDVNECETGVHRCGEGQVCHNLPGSYRCDCKA  888

Query  1189  GWVGN--GIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGF--TGDGFTCSDVDEC  1244
             G+  +  G  CID++EC     +   +  C N+ GSY C+C  GF    DG  C DV+EC
Sbjct  889   GFQRDAFGRGCIDVNECWASPGRLCQHT-CENTLGSYRCSCASGFLLAADGKRCEDVNEC  947

Query  1245  AENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQN--ICVFGTCNNLPG  1302
                   C   +C N+ G+Y+C C  G+  A D  +C DI+EC+     +C F  C N+PG
Sbjct  948   --EAQRCSQ-ECANIYGSYQCYCRQGYQLAEDGHTCTDIDECAQGAGILCTF-RCLNVPG  1003

Query  1303  MFHCIC-DDGYELDRTGGNCTDVDECA-DPINCVNG-LCVNTPGRYEC---NCPPDF  1353
              + C C + GY +   G +C DVDECA    NC     C N  G + C    CPP++
Sbjct  1004  SYQCACPEQGYTMTANGRSCKDVDECALGTHNCSEAETCHNIQGSFRCLRFECPPNY  1060


 Score = 167 bits (423),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 158/485 (33%), Positives = 214/485 (44%), Gaps = 92/485 (19%)

Query  1599  DIDECKEIPGICANGVCINQIGSFRCECPTGFSYND-------------------LLLVC  1639
             D DEC  +PG     +CIN +GS+ C C  GFS  D                     L  
Sbjct  604   DQDECLLLPGELCQHLCINTVGSYHCACFPGFSLQDDGRTCRPEGHPPQPEAPQEPALKS  663

Query  1640  EDIDECSN-------GDNLCQRNADCINS----PGSYRCECAAGFKLSPNG-ACVDRNEC  1687
             E     SN         N C+ N  C        GS  C C  G+ +  +G +C D NEC
Sbjct  664   EFSQVASNTIPLPLPQPNTCKDNGPCKQVCSTVGGSAICSCFPGYAIMADGVSCEDINEC  723

Query  1688  LEIPNVCSHG-LCVDMQGSYKC----ICHNGFKASQDQTMCMDVDECER--HPCGNG-TC  1739
             +   + CS G  CV+  GS+ C     C  G+     +  C DVDEC    H C  G  C
Sbjct  724   VTDLHTCSRGEHCVNTLGSFHCYKALTCEPGYALKDGE--CEDVDECAMGTHTCQPGFLC  781

Query  1740  KNTVGSYNC----LCYPGFELTHNNDCMDIDECSSFFGQVCRNG-RCFNEIGSFKC----  1790
             +NT GS+ C     C  GF      +C+DI+EC+S   + CR G  C N +GS+ C    
Sbjct  782   QNTKGSFYCQARQRCMDGFLQDPEGNCVDINECTSL-SEPCRPGFSCINTVGSYTCQRNP  840

Query  1791  -LCNEGYELTLDGKNCIDTNECVALPGSCSPG-TCQNLEGSFRCICPPGYEVKS--ESCI  1846
              +C  GY  + DG  C+D NEC      C  G  C NL GS+RC C  G++  +    CI
Sbjct  841   LICARGYHASDDGTKCVDVNECETGVHRCGEGQVCHNLPGSYRCDCKAGFQRDAFGRGCI  900

Query  1847  DINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSV  1906
             D+NEC   P      +C NT G ++C C +GF+L+ +G+RC D  +       E  +CS 
Sbjct  901   DVNECWASPGRLCQHTCENTLGSYRCSCASGFLLAADGKRCEDVNEC------EAQRCSQ  954

Query  1907  PKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNEC  1966
               A      +C C     +G+                 L   GH        T  D++EC
Sbjct  955   ECANIYGSYQCYCR----QGY----------------QLAEDGH--------TCTDIDEC  986

Query  1967  LESPGVCSNGHCINTDGSFRCECP-MGYNLDYTGVHCIDTDECSIG--NPCGNGTCTNVI  2023
              +  G+     C+N  GS++C CP  GY +   G  C D DEC++G  N     TC N+ 
Sbjct  987   AQGAGILCTFRCLNVPGSYQCACPEQGYTMTANGRSCKDVDECALGTHNCSEAETCHNIQ  1046

Query  2024  GSFEC  2028
             GSF C
Sbjct  1047  GSFRC  1051


 Score = 164 bits (415),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 122/322 (38%), Positives = 163/322 (51%), Gaps = 25/322 (8%)

Query  863   KDINECKVFPGMCMNG-KCRNTIGSFKC----KCNSGFTLDMEERNCTDIDECWISPDLC  917
             +D++EC +    C  G  C+NT GSF C    +C  GF  D  E NC DI+EC    + C
Sbjct  763   EDVDECAMGTHTCQPGFLCQNTKGSFYCQARQRCMDGFLQD-PEGNCVDINECTSLSEPC  821

Query  918   GSG-TCVNTPGSFECE-----CFDGYESGFMMMKNCMDIDECERNPLLC-RGGTCVNTEG  970
               G +C+NT GS+ C+     C  GY +     K C+D++ECE     C  G  C N  G
Sbjct  822   RPGFSCINTVGSYTCQRNPLICARGYHASDDGTK-CVDVNECETGVHRCGEGQVCHNLPG  880

Query  971   SFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRS  1030
             S++CDC  G +       CIDVNEC  S        C N +G+Y+CSC SG+    D + 
Sbjct  881   SYRCDCKAGFQRDAFGRGCIDVNECWASPGRLCQHTCENTLGSYRCSCASGFLLAADGKR  940

Query  1031  CTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQC  1090
             C D++EC      C   C N  GSY+C C  GY L  D  TC DIDEC     I    +C
Sbjct  941   CEDVNECEAQR--CSQECANIYGSYQCYCRQGYQLAEDGHTCTDIDECAQGAGILCTFRC  998

Query  1091  TNIPGEYRCLCYD-GFMASMDMKTCIDVNECDLNSNICMFGE-CENTKGSFIC---HCQL  1145
              N+PG Y+C C + G+  + + ++C DV+EC L ++ C   E C N +GSF C    C  
Sbjct  999   LNVPGSYQCACPEQGYTMTANGRSCKDVDECALGTHNCSEAETCHNIQGSFRCLRFECPP  1058

Query  1146  GYSVKKGT----TGCTDVDECE  1163
              Y     T    T C D  EC+
Sbjct  1059  NYVQVSKTKCERTTCHDFLECQ  1080


 Score = 139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 151/486 (31%), Positives = 202/486 (42%), Gaps = 76/486 (16%)

Query  1064  ALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLN  1123
             A +P+     D DEC   P       C N  G Y C C+ GF    D +TC    E    
Sbjct  594   AELPNSLPGDDQDECLLLPGELCQHLCINTVGSYHCACFPGFSLQDDGRTCRP--EGHPP  651

Query  1124  SNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFK  1183
                        ++ S +    +   + +  T C D   C+           C  V GS  
Sbjct  652   QPEAPQEPALKSEFSQVASNTIPLPLPQPNT-CKDNGPCK---------QVCSTVGGSAI  701

Query  1184  CSCREGW--VGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLC----ACVEGFTGDGFT  1237
             CSC  G+  + +G+ C D++EC    H CS    CVN+ GS+ C     C  G+      
Sbjct  702   CSCFPGYAIMADGVSCEDINECVTDLHTCSRGEHCVNTLGSFHCYKALTCEPGYALKDGE  761

Query  1238  CSDVDECAENVHLCENG-QCLNVPGAYRCE----CEMGFTPASDSKSCQDINEC-SFQNI  1291
             C DVDECA   H C+ G  C N  G++ C+    C  GF    +  +C DINEC S    
Sbjct  762   CEDVDECAMGTHTCQPGFLCQNTKGSFYCQARQRCMDGFLQDPEG-NCVDINECTSLSEP  820

Query  1292  CVFG-TCNNLPGMFHC-----ICDDGYELDRTGGNCTDVDECADPIN-CVNG-LCVNTPG  1343
             C  G +C N  G + C     IC  GY     G  C DV+EC   ++ C  G +C N PG
Sbjct  821   CRPGFSCINTVGSYTCQRNPLICARGYHASDDGTKCVDVNECETGVHRCGEGQVCHNLPG  880

Query  1344  RYECNCPPDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNT-EIGVGVSRSSCCCS-L  1401
              Y C+C   FQ +  G GC+D  V  C+        G L  +T E  +G  R SC    L
Sbjct  881   SYRCDCKAGFQRDAFGRGCID--VNECWAS-----PGRLCQHTCENTLGSYRCSCASGFL  933

Query  1402  GKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTF  1461
               A G  CE                              D++EC+     C    C N +
Sbjct  934   LAADGKRCE------------------------------DVNECEA--QRC-SQECANIY  960

Query  1462  GSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPE-YMQVNGG  1520
             GS+QC C +GY L+E+   C DIDEC    G+     C N  G+Y C CP + Y     G
Sbjct  961   GSYQCYCRQGYQLAEDGHTCTDIDECAQGAGILCTFRCLNVPGSYQCACPEQGYTMTANG  1020

Query  1521  HNCMDM  1526
              +C D+
Sbjct  1021  RSCKDV  1026


 Score = 137 bits (344),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 142/427 (33%), Positives = 195/427 (46%), Gaps = 73/427 (17%)

Query  281   ILNQTIDICKHHPDLCL-NGRCIPTLS----SYRCECNMGYKQDSNG-DCTDVDECTS--  332
             + + TI +    P+ C  NG C    S    S  C C  GY   ++G  C D++EC +  
Sbjct  668   VASNTIPLPLPQPNTCKDNGPCKQVCSTVGGSAICSCFPGYAIMADGVSCEDINECVTDL  727

Query  333   NPCSNGD-CVNTPGSYYC----KCHAGFQRTPTKQACIDIDECIQNGVLCKNG-RCVNTD  386
             + CS G+ CVNT GS++C     C  G+     +  C D+DEC      C+ G  C NT 
Sbjct  728   HTCSRGEHCVNTLGSFHCYKALTCEPGYALKDGE--CEDVDECAMGTHTCQPGFLCQNTK  785

Query  387   GSFQCI----CNAGFELTTDGKNCVDHDECTT-TNMCLNGM-CINEDGSFKC-----ICK  435
             GSF C     C  GF    +G NCVD +ECT+ +  C  G  CIN  GS+ C     IC 
Sbjct  786   GSFYCQARQRCMDGFLQDPEG-NCVDINECTSLSEPCRPGFSCINTVGSYTCQRNPLICA  844

Query  436   PGFVLAPNGRYCTDIDECQTS-GICMNGH-CINTEGSFRCECPPGLAVGVDGRVCVDTHM  493
              G+  + +G  C D++EC+T    C  G  C N  GS+RC+C  G      GR C+D   
Sbjct  845   RGYHASDDGTKCVDVNECETGVHRCGEGQVCHNLPGSYRCDCKAGFQRDAFGRGCIDV--  902

Query  494   RSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGLCSSGIGI  553
              + C+            PG + +  C                       +   C+SG  +
Sbjct  903   -NECWAS----------PGRLCQHTC-----------------ENTLGSYRCSCASGFLL  934

Query  554   TVDGR---DINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDIDECSVNRL  610
               DG+   D+NEC  +   CS   C N+ GSY+C C  GY+    G  C DIDEC+    
Sbjct  935   AADGKRCEDVNEC--EAQRCSQE-CANIYGSYQCYCRQGYQLAEDGHTCTDIDECAQGAG  991

Query  611   LCDNGLCRNTPGSYSCTCP-KGYVFSTETDTCEDINECE--SSPCVNG-ACRNNLGSFNC  666
             +     C N PGSY C CP +GY  +    +C+D++EC   +  C     C N  GSF C
Sbjct  992   ILCTFRCLNVPGSYQCACPEQGYTMTANGRSCKDVDECALGTHNCSEAETCHNIQGSFRC  1051

Query  667   ---ECSP  670
                EC P
Sbjct  1052  LRFECPP  1058


 Score = 130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 139/477 (29%), Positives = 196/477 (41%), Gaps = 91/477 (19%)

Query  366   DIDECIQ-NGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNC------------------  406
             D DEC+   G LC++  C+NT GS+ C C  GF L  DG+ C                  
Sbjct  604   DQDECLLLPGELCQH-LCINTVGSYHCACFPGFSLQDDGRTCRPEGHPPQPEAPQEPALK  662

Query  407   VDHDECTTTNMCL----------NG----MCINEDGSFKCICKPGFVLAPNGRYCTDIDE  452
              +  +  +  + L          NG    +C    GS  C C PG+ +  +G  C DI+E
Sbjct  663   SEFSQVASNTIPLPLPQPNTCKDNGPCKQVCSTVGGSAICSCFPGYAIMADGVSCEDINE  722

Query  453   CQTS-GICMNG-HCINTEGSFRC----ECPPGLAV-----------GVDGRVCVDTHMRS  495
             C T    C  G HC+NT GSF C     C PG A+            +    C    +  
Sbjct  723   CVTDLHTCSRGEHCVNTLGSFHCYKALTCEPGYALKDGECEDVDECAMGTHTCQPGFLCQ  782

Query  496   TCYGGIKKGACVRPFPGAVTKSECCCANPD--YGFGEPCHP-------CPAKNSAEFHGL  546
                G     A  R   G +   E  C + +      EPC P         +        +
Sbjct  783   NTKGSFYCQARQRCMDGFLQDPEGNCVDINECTSLSEPCRPGFSCINTVGSYTCQRNPLI  842

Query  547   CSSGIGITVDGR---DINECALDPDICSNG-ICENLRGSYRCNCNSGYEPDPSGRNCVDI  602
             C+ G   + DG    D+NEC      C  G +C NL GSYRC+C +G++ D  GR C+D+
Sbjct  843   CARGYHASDDGTKCVDVNECETGVHRCGEGQVCHNLPGSYRCDCKAGFQRDAFGRGCIDV  902

Query  603   DECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINECESSPCVNGACRNNLG  662
             +EC  +        C NT GSY C+C  G++ + +   CED+NECE+  C +  C N  G
Sbjct  903   NECWASPGRLCQHTCENTLGSYRCSCASGFLLAADGKRCEDVNECEAQRC-SQECANIYG  961

Query  663   SFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSP  722
             S+ C C  G +L   G  C D               E       L +  C  +  ++   
Sbjct  962   SYQCYCRQGYQLAEDGHTCTDID-------------ECAQGAGILCTFRCLNVPGSYQCA  1008

Query  723   CERCELDTACSRGFAR-VNGVTCEDVNECDVFPGVCPNGR-CINSRGSFHC---ECP  774
             C          +G+    NG +C+DV+EC +    C     C N +GSF C   ECP
Sbjct  1009  CPE--------QGYTMTANGRSCKDVDECALGTHNCSEAETCHNIQGSFRCLRFECP  1057


 Score = 124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 158/520 (30%), Positives = 208/520 (40%), Gaps = 112/520 (22%)

Query  287   DICKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNGDC-------------------TDV  327
             ++C+H   LC+N     T+ SY C C  G+    +G                     ++ 
Sbjct  614   ELCQH---LCIN-----TVGSYHCACFPGFSLQDDGRTCRPEGHPPQPEAPQEPALKSEF  665

Query  328   DECTSN----------------PCSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECI  371
              +  SN                PC    C    GS  C C  G+       +C DI+EC+
Sbjct  666   SQVASNTIPLPLPQPNTCKDNGPCKQ-VCSTVGGSAICSCFPGYAIMADGVSCEDINECV  724

Query  372   QNGVLCKNG-RCVNTDGSFQC----ICNAGFELTTDGKNCVDHDECTT-TNMCLNG-MCI  424
              +   C  G  CVNT GSF C     C  G+ L  DG+ C D DEC   T+ C  G +C 
Sbjct  725   TDLHTCSRGEHCVNTLGSFHCYKALTCEPGYAL-KDGE-CEDVDECAMGTHTCQPGFLCQ  782

Query  425   NEDGSFKCI----CKPGFVLAPNGRYCTDIDECQT-SGICMNGH-CINTEGSFRCE----  474
             N  GSF C     C  GF+  P G  C DI+EC + S  C  G  CINT GS+ C+    
Sbjct  783   NTKGSFYCQARQRCMDGFLQDPEGN-CVDINECTSLSEPCRPGFSCINTVGSYTCQRNPL  841

Query  475   -CPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCH  533
              C  G     DG  CVD    + C  G+ +                       G G+ CH
Sbjct  842   ICARGYHASDDGTKCVDV---NECETGVHR----------------------CGEGQVCH  876

Query  534   PCPAKNSAEFHGLCSSGIGITVDGR---DINECALDPDICSNGICENLRGSYRCNCNSGY  590
               P     +    C +G      GR   D+NEC   P       CEN  GSYRC+C SG+
Sbjct  877   NLPGSYRCD----CKAGFQRDAFGRGCIDVNECWASPGRLCQHTCENTLGSYRCSCASGF  932

Query  591   EPDPSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINECESS  650
                  G+ C D++EC   R    +  C N  GSY C C +GY  + +  TC DI+EC   
Sbjct  933   LLAADGKRCEDVNECEAQRC---SQECANIYGSYQCYCRQGYQLAEDGHTCTDIDECAQG  989

Query  651   PCV--NGACRNNLGSFNCEC-SPGSKLDSTGLICIDSLKGTCWLNIQD-SRCEV--NING  704
               +     C N  GS+ C C   G  + + G  C D     C L   + S  E   NI G
Sbjct  990   AGILCTFRCLNVPGSYQCACPEQGYTMTANGRSCKDV--DECALGTHNCSEAETCHNIQG  1047

Query  705   AT--LKSECCATLGAAWGSPCER--CELDTACSRGFARVN  740
             +   L+ EC         + CER  C     C    AR+ 
Sbjct  1048  SFRCLRFECPPNYVQVSKTKCERTTCHDFLECQNSPARIT  1087


 Score = 122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 159/557 (29%), Positives = 219/557 (39%), Gaps = 111/557 (20%)

Query  442   PNGRYCTDIDECQT-SGICMNGHCINTEGSFRCECPPGLAVGVDGRVC------------  488
             PN     D DEC    G      CINT GS+ C C PG ++  DGR C            
Sbjct  597   PNSLPGDDQDECLLLPGELCQHLCINTVGSYHCACFPGFSLQDDGRTCRPEGHPPQPEAP  656

Query  489   VDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGLCS  548
              +  ++S  +  +       P P   T  +            PC    +         C 
Sbjct  657   QEPALKSE-FSQVASNTIPLPLPQPNTCKD----------NGPCKQVCSTVGGSAICSCF  705

Query  549   SGIGITVDG---RDINECALDPDICSNG-ICENLRGSYRCNCNSGYEPDPSGRN--CVDI  602
              G  I  DG    DINEC  D   CS G  C N  GS+ C      EP  + ++  C D+
Sbjct  706   PGYAIMADGVSCEDINECVTDLHTCSRGEHCVNTLGSFHCYKALTCEPGYALKDGECEDV  765

Query  603   DECSVNRLLCDNG-LCRNTPGSYSCT----CPKGYVFSTETDTCEDINECES--SPCVNG  655
             DEC++    C  G LC+NT GS+ C     C  G++   E + C DINEC S   PC  G
Sbjct  766   DECAMGTHTCQPGFLCQNTKGSFYCQARQRCMDGFLQDPEGN-CVDINECTSLSEPCRPG  824

Query  656   -ACRNNLGSFNCE-----CSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKS  709
              +C N +GS+ C+     C+ G      G  C+D            + CE  ++    + 
Sbjct  825   FSCINTVGSYTCQRNPLICARGYHASDDGTKCVDV-----------NECETGVHRCG-EG  872

Query  710   ECCATLGAAWGSPCERCELDTACSRGFAR-VNGVTCEDVNECDVFPGVCPNGRCINSRGS  768
             + C  L  ++     RC+    C  GF R   G  C DVNEC   PG      C N+ GS
Sbjct  873   QVCHNLPGSY-----RCD----CKAGFQRDAFGRGCIDVNECWASPGRLCQHTCENTLGS  923

Query  769   FHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRMDACCCAVGAAWGSDC  828
             + C C  G  L   G+ C D+           +EC            C       +GS  
Sbjct  924   YRCSCASGFLLAADGKRCEDV-----------NEC--------EAQRCSQECANIYGS--  962

Query  829   EECPKPDTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFK  888
                       Y+  C +G   +  G   T      DI+EC    G+    +C N  GS++
Sbjct  963   ----------YQCYCRQGYQLAEDGHTCT------DIDECAQGAGILCTFRCLNVPGSYQ  1006

Query  889   CKC-NSGFTLDMEERNCTDIDECWISPDLCGSG-TCVNTPGSFECECFDGYESGFMMMK-  945
             C C   G+T+    R+C D+DEC +    C    TC N  GSF C  F+   +   + K 
Sbjct  1007  CACPEQGYTMTANGRSCKDVDECALGTHNCSEAETCHNIQGSFRCLRFECPPNYVQVSKT  1066

Query  946   -----NCMDIDECERNP  957
                   C D  EC+ +P
Sbjct  1067  KCERTTCHDFLECQNSP  1083


 Score = 120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 131/404 (32%), Positives = 173/404 (43%), Gaps = 86/404 (21%)

Query  1683  DRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMC-------------------  1723
             D++ECL +P      LC++  GSY C C  GF    D   C                   
Sbjct  604   DQDECLLLPGELCQHLCINTVGSYHCACFPGFSLQDDGRTCRPEGHPPQPEAPQEPALKS  663

Query  1724  ---------MDVDECERHPCG-NGTCK---NTVG-SYNCLCYPGFELTHNN-DCMDIDEC  1768
                      + +   + + C  NG CK   +TVG S  C C+PG+ +  +   C DI+EC
Sbjct  664   EFSQVASNTIPLPLPQPNTCKDNGPCKQVCSTVGGSAICSCFPGYAIMADGVSCEDINEC  723

Query  1769  SSFFGQVCRNGRCFNEIGSFKCL----CNEGYELTLDGKNCIDTNECVALPGSCSPG-TC  1823
              +      R   C N +GSF C     C  GY L  DG+ C D +EC     +C PG  C
Sbjct  724   VTDLHTCSRGEHCVNTLGSFHCYKALTCEPGYALK-DGE-CEDVDECAMGTHTCQPGFLC  781

Query  1824  QNLEGSFRCI----CPPGYEVKSE-SCIDINECNEDPNICLFG-SCTNTPGGFQC-----  1872
             QN +GSF C     C  G+    E +C+DINEC      C  G SC NT G + C     
Sbjct  782   QNTKGSFYCQARQRCMDGFLQDPEGNCVDINECTSLSEPCRPGFSCINTVGSYTCQRNPL  841

Query  1873  ICPTGFVLSDNGRRCFDTRQSFCFTNFEN-GKCSVPKAFNTTKAKCCCSKMPGEGWGDPC  1931
             IC  G+  SD+G +C D  +  C T     G+  V            C  +PG    D  
Sbjct  842   ICARGYHASDDGTKCVDVNE--CETGVHRCGEGQV------------CHNLPGSYRCD--  885

Query  1932  ELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPM  1991
               C    +  FQ    +G G I        DVNEC  SPG      C NT GS+RC C  
Sbjct  886   --C----KAGFQRDA-FGRGCI--------DVNECWASPGRLCQHTCENTLGSYRCSCAS  930

Query  1992  GYNLDYTGVHCIDTDECSIGNPCGNGTCTNVIGSFECNCHEGFE  2035
             G+ L   G  C D +EC     C    C N+ GS++C C +G++
Sbjct  931   GFLLAADGKRCEDVNECE-AQRCSQ-ECANIYGSYQCYCRQGYQ  972


 Score = 119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 143/482 (30%), Positives = 205/482 (43%), Gaps = 59/482 (12%)

Query  1323  DVDECAD-PINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDN---RVGNCYLKYGPRG  1378
             D DEC   P      LC+NT G Y C C P F L   G  C             +   + 
Sbjct  604   DQDECLLLPGELCQHLCINTVGSYHCACFPGFSLQDDGRTCRPEGHPPQPEAPQEPALKS  663

Query  1379  DGSLSCNTEIGVGVSRSSCCCSLGKAWGNPC-ETCPPVNSTEYNTLCPGGEGFRPNPITI  1437
             + S   +  I + + + + C   G     PC + C  V  +    +C    G+      +
Sbjct  664   EFSQVASNTIPLPLPQPNTCKDNG-----PCKQVCSTVGGS---AICSCFPGYAIMADGV  715

Query  1438  ILEDIDEC-QELPGLCQGGNCINTFGSFQC----ECPKGYYLSEETRICEDIDECVAHPG  1492
               EDI+EC  +L    +G +C+NT GSF C     C  GY L +    CED+DEC     
Sbjct  716   SCEDINECVTDLHTCSRGEHCVNTLGSFHCYKALTCEPGYALKDGE--CEDVDECAMGTH  773

Query  1493  VCGPG-TCYNTLGNYTCI----CPPEYMQVNGGHNCMDMRK--SFCYRSYNGTSCENELP  1545
              C PG  C NT G++ C     C   ++Q   G NC+D+ +  S       G SC N + 
Sbjct  774   TCQPGFLCQNTKGSFYCQARQRCMDGFLQDPEG-NCVDINECTSLSEPCRPGFSCINTVG  832

Query  1546  FNVTKR---MCCCTYNVGKAWNKPCEPCPTPGTAEFK----NICGNIPG---------FT  1589
                 +R   +C   Y+      K C       T   +     +C N+PG         F 
Sbjct  833   SYTCQRNPLICARGYHASDDGTK-CVDVNECETGVHRCGEGQVCHNLPGSYRCDCKAGFQ  891

Query  1590  FDIHSGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGD  1649
              D      +D++EC   PG      C N +GS+RC C +GF        CED++EC    
Sbjct  892   RDAFGRGCIDVNECWASPGRLCQHTCENTLGSYRCSCASGFLLAADGKRCEDVNECE---  948

Query  1650  NLCQR-NADCINSPGSYRCECAAGFKLSPNG-ACVDRNECLEIPNVCSHGLCVDMQGSYK  1707
                QR + +C N  GSY+C C  G++L+ +G  C D +EC +   +     C+++ GSY+
Sbjct  949   --AQRCSQECANIYGSYQCYCRQGYQLAEDGHTCTDIDECAQGAGILCTFRCLNVPGSYQ  1006

Query  1708  CIC-HNGFKASQDQTMCMDVDECE--RHPCGNG-TCKNTVGSYNCL---CYPGFELTHNN  1760
             C C   G+  + +   C DVDEC    H C    TC N  GS+ CL   C P +      
Sbjct  1007  CACPEQGYTMTANGRSCKDVDECALGTHNCSEAETCHNIQGSFRCLRFECPPNYVQVSKT  1066

Query  1761  DC  1762
              C
Sbjct  1067  KC  1068


 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 143/522 (27%), Positives = 185/522 (35%), Gaps = 126/522 (24%)

Query  1597  AVDIDECKEIP------GICANGV---CINQIGSFRCECPTGFSYNDLLLVCEDIDECSN  1647
             A+D DEC EIP       +C       C++ +    C      +        ED D C  
Sbjct  453   AIDNDECLEIPESGTEDNVCRTAQRHCCVSYLQEKSCMAGVLGAKEGETCGAEDNDSC--  510

Query  1648  GDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDMQGSYK  1707
             G +L ++  DC          C  G ++   G   + N  L  P  C+H +    +G   
Sbjct  511   GISLYKQCCDC----------CGLGLRVRAEGQSCESNPNLGYP--CNHVMLSCCEGEEP  558

Query  1708  CICHNGFKASQDQTMCMDVDECE---RHPCGNGT--------------------------  1738
              I     +  +       V E E   R     GT                          
Sbjct  559   LIVPEVRRPPEPAAAPRRVSEAEMAGREALSLGTEAELPNSLPGDDQDECLLLPGELCQH  618

Query  1739  -CKNTVGSYNCLCYPGFELTHNNDC------------MDIDECSSFFGQVCRN-------  1778
              C NTVGSY+C C+PGF L  +                      S F QV  N       
Sbjct  619   LCINTVGSYHCACFPGFSLQDDGRTCRPEGHPPQPEAPQEPALKSEFSQVASNTIPLPLP  678

Query  1779  ------------GRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGT-CQN  1825
                           C    GS  C C  GY +  DG +C D NECV    +CS G  C N
Sbjct  679   QPNTCKDNGPCKQVCSTVGGSAICSCFPGYAIMADGVSCEDINECVTDLHTCSRGEHCVN  738

Query  1826  LEGSFRC----ICPPGYEVKSESCIDINECNEDPNICLFG-SCTNTPGGFQCI----CPT  1876
               GSF C     C PGY +K   C D++EC    + C  G  C NT G F C     C  
Sbjct  739   TLGSFHCYKALTCEPGYALKDGECEDVDECAMGTHTCQPGFLCQNTKGSFYCQARQRCMD  798

Query  1877  GFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPK  1936
             GF L D    C D  +    +      C    +   T     C + P             
Sbjct  799   GF-LQDPEGNCVDINECTSLSE----PCRPGFSCINTVGSYTCQRNP-------------  840

Query  1937  EEEVAFQDLCPYGHGTIPGIDDTR-EDVNECLESPGVCSNGH-CINTDGSFRCECPMGYN  1994
                     +C  G+      D T+  DVNEC      C  G  C N  GS+RC+C  G+ 
Sbjct  841   -------LICARGYHA--SDDGTKCVDVNECETGVHRCGEGQVCHNLPGSYRCDCKAGFQ  891

Query  1995  LDYTGVHCIDTDEC--SIGNPCGNGTCTNVIGSFECNCHEGF  2034
              D  G  CID +EC  S G  C + TC N +GS+ C+C  GF
Sbjct  892   RDAFGRGCIDVNECWASPGRLCQH-TCENTLGSYRCSCASGF  932


 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 70/145 (48%), Gaps = 7/145 (5%)

Query  45   CPAQPQPCRRGFIPNIRTGACQDVDECQAIPGVC-QGGNCINTVGSYECKCPAGHKQNEA  103
            C   P  C RG+  +     C DV+EC+     C +G  C N  GSY C C AG +++  
Sbjct  836  CQRNPLICARGYHASDDGTKCVDVNECETGVHRCGEGQVCHNLPGSYRCDCKAGFQRDAF  895

Query  104  TQKCDDIDECSIIPGICEGSECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVN  163
             + C D++EC   PG      C NT+GSY C C  G++ + DG RC D   + C +    
Sbjct  896  GRGCIDVNECWASPGRLCQHTCENTLGSYRCSCASGFLLAADGKRCED--VNECEAQ---  950

Query  164  GRCAQELPGRFTKRQCCCESGRCWA  188
             RC+QE    +   QC C  G   A
Sbjct  951  -RCSQECANIYGSYQCYCRQGYQLA  974


 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 60/124 (48%), Gaps = 5/124 (4%)

Query  30    CCATIGRAWGHPCEMCPAQPQ-PCRRGFIPNIRTGACQDVDECQAIPGVCQGGNCINTVG  88
             C A+ GR   H CE      +  C  GF+       C+DV+EC+A    C    C N  G
Sbjct  905   CWASPGRLCQHTCENTLGSYRCSCASGFLLAADGKRCEDVNECEA--QRC-SQECANIYG  961

Query  89    SYECKCPAGHKQNEATQKCDDIDECSIIPGICEGSECSNTVGSYFCICP-RGYVTSTDGS  147
             SY+C C  G++  E    C DIDEC+   GI     C N  GSY C CP +GY  + +G 
Sbjct  962   SYQCYCRQGYQLAEDGHTCTDIDECAQGAGILCTFRCLNVPGSYQCACPEQGYTMTANGR  1021

Query  148   RCID  151
              C D
Sbjct  1022  SCKD  1025


 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 69/137 (50%), Gaps = 16/137 (12%)

Query  60   IRTGACQDVDECQAIPGVCQGGN-CINTVGSYEC----KCPAGHKQNEATQKCDDIDECS  114
            ++ G C+DVDEC      CQ G  C NT GS+ C    +C  G  Q+     C DI+EC+
Sbjct  757  LKDGECEDVDECAMGTHTCQPGFLCQNTKGSFYCQARQRCMDGFLQD-PEGNCVDINECT  815

Query  115  IIPGICE-GSECSNTVGSYFC-----ICPRGYVTSTDGSRCID-QRASTCFSNIVNGRCA  167
             +   C  G  C NTVGSY C     IC RGY  S DG++C+D     T       G+  
Sbjct  816  SLSEPCRPGFSCINTVGSYTCQRNPLICARGYHASDDGTKCVDVNECETGVHRCGEGQVC  875

Query  168  QELPGRFTKRQCCCESG  184
              LPG +   +C C++G
Sbjct  876  HNLPGSY---RCDCKAG  889


> sp|Q99466|NOTC4_HUMAN Neurogenic locus notch homolog protein 
4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2
Length=2003

 Score = 183 bits (465),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 314/1143 (27%), Positives = 447/1143 (39%), Gaps = 229/1143 (20%)

Query  875   CMNGK-CRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGT-CVNTPGSFECE  932
             C+NG  C  T    +C C  GF     ER   D++EC+  P  C  GT C NT GSF+C 
Sbjct  165   CVNGGVCLATYPQIQCHCPPGFEGHACER---DVNECFQDPGPCPKGTSCHNTLGSFQCL  221

Query  933   CFDGYESGFMMMK-------------NCMDIDE------------------CERNPLLC-  960
             C  G E     ++              C  + E                  CE NP  C 
Sbjct  222   CPVGQEGPRCELRAGPCPPRGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCV  281

Query  961   -----RGGTCVNTEGSFQCDCPLGHELSPSREECIDVNEC-SLSDSLCRNG-KCVNMVGT  1013
                   GGTC +   ++ C CP   E     +   DV+EC +     CRNG  C N  G+
Sbjct  282   SHQCQNGGTCQDGLDTYTCLCP---ETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGS  338

Query  1014  YQCSCNSGYQATPDRRSCTD-IDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTC  1072
             + C C SG+  T    SC + +D+C+       + C +  GS+ C C  G   +     C
Sbjct  339   FHCVCVSGWGGT----SCEENLDDCIAATCAPGSTCIDRVGSFSCLCPPGRTGL----LC  390

Query  1073  ADIDECESNPDICDG-GQCTNIP--GEYRCLC---YDGFMASMDMKTCIDVNECDLNSNI  1126
                D C S P  C G  QC+  P  G   CLC   Y G     D+  C+   +     + 
Sbjct  391   HLEDMCLSQP--CHGDAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDECLMAQQ---GPSP  445

Query  1127  CMFG-ECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCS  1185
             C  G  C NT GSF C C  GY+  +      + D  E  +  C   ++C+++  +F C 
Sbjct  446   CEHGGSCLNTPGSFNCLCPPGYTGSR-----CEADHNECLSQPCHPGSTCLDLLATFHCL  500

Query  1186  CREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECA  1245
             C  G  G   + ++ +EC++    C  +A C +    + C C+ GF+G      D+DEC 
Sbjct  501   CPPGLEGQLCE-VETNECASAP--CLNHADCHDLLNGFQCICLPGFSGTRCE-EDIDECR  556

Query  1246  ENVHLCENG-QCLNVPGAYRCECEMGFTPASDSKSCQ-DINECSFQNICVFGTCNNLPGM  1303
              +   C NG QC + PGA+ C+C  GF    +   CQ +++EC      V  +C +LPG 
Sbjct  557   SSP--CANGGQCQDQPGAFHCKCLPGF----EGPRCQTEVDECLSDPCPVGASCLDLPGA  610

Query  1304  FHCICDDGYELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCV  1363
             F C+C  G+      G   +V  CA  +     +C +   +  C CP          GC 
Sbjct  611   FFCLCPSGFT-----GQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDG------SPGCA  659

Query  1364  DNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCE---TCPPVNSTEY  1420
                  NC   +G     S  C+    VG +   C   LG     PC    TC P  S  Y
Sbjct  660   PPE-DNCTCHHGHCQRSSCVCD----VGWTGPECEAELGGCISAPCAHGGTCYPQPSG-Y  713

Query  1421  NTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRI  1480
             N  CP G            E++  C   P L  GG+C  + G + C CP  +   +    
Sbjct  714   NCTCPTGYTG-----PTCSEEMTACHSGPCL-NGGSCNPSPGGYYCTCPPSHTGPQ----  763

Query  1481  CE-DIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKS----------  1529
             C+   D CV+ P   G GTC N  G ++C+C    M   G      +R S          
Sbjct  764   CQTSTDYCVSAPCFNG-GTCVNRPGTFSCLC---AMGFQGPRCEGKLRPSCADSPCRNRA  819

Query  1530  -----------FCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEF  1578
                         C   Y G SC+  +     K    C  N       P           F
Sbjct  820   TCQDSPQGPRCLCPTGYTGGSCQTLMDLCAQKP---CPRNSHCLQTGP----------SF  866

Query  1579  KNICGNIPGFT-----FDIHSGKAVDIDECKEIPGICANG-VCINQIGSFRCECPTGFSY  1632
               +C  + G+T       + S +   + +  ++  +C NG +C++   S+ C CP GF  
Sbjct  867   HCLC--LQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLCVDSGPSYFCHCPPGFQG  924

Query  1633  NDLLLVCED-IDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIP  1691
             +    +C+D ++ C +    CQ  A C+  P  Y C+CA G+         D   C +  
Sbjct  925   S----LCQDHVNPCES--RPCQNGATCMAQPSGYLCQCAPGY---------DGQNCSKEL  969

Query  1692  NVCS------HGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPC---GNGTCKNT  1742
             + C       HG C    G + C C  GF   + +    DVDEC   PC   G   C + 
Sbjct  970   DACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEG---DVDECLDQPCHPTGTAACHSL  1026

Query  1743  VGSYNCLCYPGFELTHNNDCMDIDECSSFFGQVC-RNGRCFNEIGS---FKCLCNEGYE-  1797
               ++ C C PG   T     ++ID C S   Q C   G C    GS   F C C +G+E 
Sbjct  1027  ANAFYCQCLPGH--TGQWCEVEIDPCHS---QPCFHGGTCEATAGSPLGFICHCPKGFEG  1081

Query  1798  -------LTLDGKNCIDTNECVALPGSCSPGTCQNLE--GSFRCICPPGYEVKSESCIDI  1848
                     +    +C     C+  P    P  C  L   G   C+ PP      + C   
Sbjct  1082  PTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPP----APKGC---  1134

Query  1849  NECNEDPNICLF-GSCTNTPG----GFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGK  1903
                   P+ CL+ GSC+ T G    GF+C CP     S  G RC       C     +G 
Sbjct  1135  ----GPPSPCLYNGSCSETTGLGGPGFRCSCPH----SSPGPRCQKPGAKGCEGRSGDGA  1186

Query  1904  CSV  1906
             C  
Sbjct  1187  CDA  1189


 Score = 165 bits (417),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 299/1111 (27%), Positives = 437/1111 (39%), Gaps = 235/1111 (21%)

Query  333   NPCSNG-DCVN-TPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNG----------  380
              PC+NG  C++ + G   C+C  GF      + C   D C QN  LC+NG          
Sbjct  33    EPCANGGTCLSLSLGQGTCQCAPGF----LGETCQFPDPC-QNAQLCQNGGSCQALLPAP  87

Query  381   -----RCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMC-INEDGSFKCIC  434
                         SF C C  GF  T +       D C  +     G C I   G  +C C
Sbjct  88    LGLPSSPSPLTPSFLCTCLPGF--TGERCQAKLEDPCPPSFCSKRGRCHIQASGRPQCSC  145

Query  435   KPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCECPPGL---AVGVDGRVCVDT  491
              PG+     G  C   D C  +     G C+ T    +C CPPG    A   D   C   
Sbjct  146   MPGWT----GEQCQLRDFCSANPCVNGGVCLATYPQIQCHCPPGFEGHACERDVNECFQD  201

Query  492   ----HMRSTCYGGIKKGACVRPFPGAVTKSECCCAN-PDYG--FGEPCHPCPAKNSAEFH  544
                    ++C+  +    C+ P      + E      P  G   G  C   P K+S    
Sbjct  202   PGPCPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPCPPRGCSNGGTCQLMPEKDSTFHL  261

Query  545   GLCSSGIGITVDGRDINECALDPDIC------SNGICENLRGSYRCNCNSGYEPDPSGRN  598
              LC  G  I  D      C ++PD C      + G C++   +Y C C   +    +G +
Sbjct  262   CLCPPGF-IGPD------CEVNPDNCVSHQCQNGGTCQDGLDTYTCLCPETW----TGWD  310

Query  599   CV-DIDECSVN-RLLCDN-GLCRNTPGSYSCTCPKGYVFSTETDTCEDINECESSPCVNG  655
             C  D+DEC       C N G C+N+ GS+ C C  G+     T   E++++C ++ C  G
Sbjct  311   CSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGW---GGTSCEENLDDCIAATCAPG  367

Query  656   A-CRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNI--QDSRCEVN-INGATLKSEC  711
             + C + +GSF+C C PG     TGL+C   L+  C       D++C  N + G+TL    
Sbjct  368   STCIDRVGSFSCLCPPG----RTGLLC--HLEDMCLSQPCHGDAQCSTNPLTGSTL----  417

Query  712   CATLGAAWGSPCERCELDTACSRGFARVNGVTC-EDVNECDVF---PGVCPN-GRCINSR  766
                                 C  G+   +G TC +D++EC +    P  C + G C+N+ 
Sbjct  418   ------------------CLCQPGY---SGPTCHQDLDECLMAQQGPSPCEHGGSCLNTP  456

Query  767   GSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSV--PGKFRMDACCCAVGAAW  824
             GSF+C CP G     TG  C            D +EC+     PG   +D          
Sbjct  457   GSFNCLCPPGY----TGSRC----------EADHNECLSQPCHPGSTCLDL---------  493

Query  825   GSDCEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMN-GKCRNT  883
                           +  LCP G         L G+    + NEC   P  C+N   C + 
Sbjct  494   -----------LATFHCLCPPG---------LEGQLCEVETNECASAP--CLNHADCHDL  531

Query  884   IGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMM  943
             +  F+C C  GF+    E    DIDEC  SP   G G C + PG+F C+C  G+E     
Sbjct  532   LNGFQCICLPGFSGTRCEE---DIDECRSSPCANG-GQCQDQPGAFHCKCLPGFEGPRCQ  587

Query  944   MKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGH------------ELSPSREECID  991
                  ++DEC  +P    G +C++  G+F C CP G              L   ++ C D
Sbjct  588   ----TEVDECLSDPCPV-GASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKD  642

Query  992   VNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCT-DI----DECMIMNGGCHT  1046
               +   ++ LC +G          C+C+ G+     R SC  D+     EC    GGC +
Sbjct  643   QKD--KANCLCPDGSPGCAPPEDNCTCHHGHC---QRSSCVCDVGWTGPECEAELGGCIS  697

Query  1047  H-------CTNSEGSYECSCSDGYALMPDVRTCA-DIDECESNPDICDGGQCTNIPGEYR  1098
                     C      Y C+C  GY       TC+ ++  C S P + +GG C   PG Y 
Sbjct  698   APCAHGGTCYPQPSGYNCTCPTGYT----GPTCSEEMTACHSGPCL-NGGSCNPSPGGYY  752

Query  1099  CLCYDGFMASMDMKTCIDVNECDLNSNICMF------GECENTKGSFICHCQLGYSVKKG  1152
             C C                 +C  +++ C+       G C N  G+F C C +G+   + 
Sbjct  753   CTCPPSHTGP----------QCQTSTDYCVSAPCFNGGTCVNRPGTFSCLCAMGFQGPR-  801

Query  1153  TTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSV  1212
                C            C   A+C + P   +C C  G+ G   + + +D C+     C  
Sbjct  802   ---CEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGSCQTL-MDLCAQ--KPCPR  855

Query  1213  NAQCVNSPGSYLCACVEGFTGD--GFTCSDVDECA-----ENVHLCEN-GQCLNVPGAYR  1264
             N+ C+ +  S+ C C++G+TG       S   + A     +   LC N G C++   +Y 
Sbjct  856   NSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLCVDSGPSYF  915

Query  1265  CECEMGFTPASDSKSCQD-INECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCT-  1322
             C C  GF        CQD +N C  +      TC   P  + C C  GY+    G NC+ 
Sbjct  916   CHCPPGF----QGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGYD----GQNCSK  967

Query  1323  DVDECADPINCVNGLCVNTPGRYECNCPPDF  1353
             ++D C       +G C   PG + C CPP F
Sbjct  968   ELDACQSQPCHNHGTCTPKPGGFHCACPPGF  998


 Score = 150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 321/1165 (28%), Positives = 442/1165 (38%), Gaps = 240/1165 (21%)

Query  274   PIITGLTILNQTIDICKHHPDLC-LNGRC-IPTLSSYRCECNMGYKQDSNGDCTDVDECT  331
             P  TG     +  D C   P  C   GRC I      +C C  G+  +    C   D C+
Sbjct  107   PGFTGERCQAKLEDPCP--PSFCSKRGRCHIQASGRPQCSCMPGWTGE---QCQLRDFCS  161

Query  332   SNPCSNGD-CVNTPGSYYCKCHAGFQRTPTKQAC-IDIDECIQNGVLCKNG-RCVNTDGS  388
             +NPC NG  C+ T     C C  GF+      AC  D++EC Q+   C  G  C NT GS
Sbjct  162   ANPCVNGGVCLATYPQIQCHCPPGFE----GHACERDVNECFQDPGPCPKGTSCHNTLGS  217

Query  389   FQCICNAGFELTTDGKNCVDHDECTTTNMCLNG----MCINEDGSFK-CICKPGFV----  439
             FQC+C  G E    G  C           C NG    +   +D +F  C+C PGF+    
Sbjct  218   FQCLCPVGQE----GPRCELRAGPCPPRGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDC  273

Query  440   -LAP---------NGRYCT---------------------DIDECQTSGI--CMN-GHCI  465
              + P         NG  C                      D+DEC+T G   C N G C 
Sbjct  274   EVNPDNCVSHQCQNGGTCQDGLDTYTCLCPETWTGWDCSEDVDECETQGPPHCRNGGTCQ  333

Query  466   NTEGSFRCECPPGLA-----VGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECC  520
             N+ GSF C C  G         +D  +       STC   +   +C+ P PG   ++   
Sbjct  334   NSAGSFHCVCVSGWGGTSCEENLDDCIAATCAPGSTCIDRVGSFSCLCP-PG---RTGLL  389

Query  521   CANPDYGFGEPCHPCPAKNSAEFHG----LCSSGIGITVDGRDINECALD---PDICSN-  572
             C   D    +PCH     ++    G    LC  G       +D++EC +    P  C + 
Sbjct  390   CHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDECLMAQQGPSPCEHG  449

Query  573   GICENLRGSYRCNCNSGYEPDPSGRNC-VDIDECSVNRLLCDNGLCRNTPGSYSCTCPKG  631
             G C N  GS+ C C  GY    +G  C  D +EC +++       C +   ++ C CP G
Sbjct  450   GSCLNTPGSFNCLCPPGY----TGSRCEADHNEC-LSQPCHPGSTCLDLLATFHCLCPPG  504

Query  632   YVFSTETDTCE-DINECESSPCVNGA-CRNNLGSFNCECSPGSKLDSTGLICIDSLKGTC  689
                  E   CE + NEC S+PC+N A C + L  F C C PG                  
Sbjct  505   L----EGQLCEVETNECASAPCLNHADCHDLLNGFQCICLPG------------------  542

Query  690   WLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVNGVTCE-DVN  748
                   +RCE +I+    +S  CA  G     P         C  GF    G  C+ +V+
Sbjct  543   ---FSGTRCEEDID--ECRSSPCANGGQCQDQP---GAFHCKCLPGF---EGPRCQTEVD  591

Query  749   ECDVFPGVCPNG-RCINSRGSFHCECPEGLT------------LDGTGRVCLDIRMEQCY  795
             EC   P  CP G  C++  G+F C CP G T            L    ++C D + +   
Sbjct  592   ECLSDP--CPVGASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANC  649

Query  796   LTWD--------EDECIRSVPGKFRMDACCCAVGAAW-GSDCE-------ECP-------  832
             L  D        ED C     G  +  +C C VG  W G +CE         P       
Sbjct  650   LCPDGSPGCAPPEDNCTCHH-GHCQRSSCVCDVG--WTGPECEAELGGCISAPCAHGGTC  706

Query  833   KPDTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMN-GKCRNTIGSFKCKC  891
              P    Y   CP G          TG    +++  C   P  C+N G C  + G + C C
Sbjct  707   YPQPSGYNCTCPTG---------YTGPTCSEEMTACHSGP--CLNGGSCNPSPGGYYCTC  755

Query  892   NSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGF---MMMKNCM  948
                 T    +   T  D C  +P   G GTCVN PG+F C C  G++       +  +C 
Sbjct  756   PPSHTGPQCQ---TSTDYCVSAPCFNG-GTCVNRPGTFSCLCAMGFQGPRCEGKLRPSCA  811

Query  949   DIDECERNPLLCRG-GTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKC  1007
             D          CR   TC ++    +C CP G+    +   C  + +        RN  C
Sbjct  812   DSP--------CRNRATCQDSPQGPRCLCPTGY----TGGSCQTLMDLCAQKPCPRNSHC  859

Query  1008  VNMVGTYQCSCNSGYQAT---PDRRSCTD--IDECMIMNGGCHT--HCTNSEGSYECSCS  1060
             +    ++ C C  G+          SC    + + + ++  CH    C +S  SY C C 
Sbjct  860   LQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLCVDSGPSYFCHCP  919

Query  1061  DGYALMPDVRTCAD-IDECESNPDICDGGQCTNIPGEYRCLC---YDGFMASMDMKTCID  1116
              G+        C D ++ CES P   +G  C   P  Y C C   YDG   S ++  C  
Sbjct  920   PGF----QGSLCQDHVNPCESRP-CQNGATCMAQPSGYLCQCAPGYDGQNCSKELDAC--  972

Query  1117  VNECDLNSNICM-FGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASC  1175
                    S  C   G C    G F C C  G+    G     DVDEC     +    A+C
Sbjct  973   ------QSQPCHNHGTCTPKPGGFHCACPPGFV---GLRCEGDVDECLDQPCHPTGTAAC  1023

Query  1176  VNVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSVNAQC---VNSPGSYLCACVEGFT  1232
              ++  +F C C  G  G   + +++D C   +  C     C     SP  ++C C +GF 
Sbjct  1024  HSLANAFYCQCLPGHTGQWCE-VEIDPCH--SQPCFHGGTCEATAGSPLGFICHCPKGF-  1079

Query  1233  GDGFTCSDVDECAENVHLCENGQCLNVPG---AYRCECEMGF------TPASDSKSCQDI  1283
              +G TCS         H    G CL  P      RC C  G+      TP +  K C   
Sbjct  1080  -EGPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPA-PKGCGPP  1137

Query  1284  NECSFQNICVFGTCNNLPGMFHCIC  1308
             + C +   C   T    PG F C C
Sbjct  1138  SPCLYNGSCSETTGLGGPG-FRCSC  1161


 Score = 146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 294/1120 (26%), Positives = 428/1120 (38%), Gaps = 256/1120 (23%)

Query  868   CKVFPGMCMNGK--CRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSG----T  921
             C  FP  C NG      ++G   C+C  GF  +     C   D C  +  LC +G     
Sbjct  28    CGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGE----TCQFPDPCQNA-QLCQNGGSCQA  82

Query  922   CVNTP-----------GSFECECFDGYESGFMMMKNCMDIDECERNPLLC--RGGTCVNT  968
              +  P            SF C C  G+       + C    E    P  C  RG   +  
Sbjct  83    LLPAPLGLPSSPSPLTPSFLCTCLPGFTG-----ERCQAKLEDPCPPSFCSKRGRCHIQA  137

Query  969   EGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDR  1028
              G  QC C  G     + E+C   + CS ++     G C+      QC C  G++     
Sbjct  138   SGRPQCSCMPGW----TGEQCQLRDFCS-ANPCVNGGVCLATYPQIQCHCPPGFEGHACE  192

Query  1029  RSCTDIDECMIMNGGCH--THCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDIC-  1085
             R   D++EC    G C   T C N+ GS++C C  G           +   CE     C 
Sbjct  193   R---DVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGQ----------EGPRCELRAGPCP  239

Query  1086  -----DGGQCTNIPGE----YRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTK  1136
                  +GG C  +P +    + CLC  GF+            +C++N + C+  +C+N  
Sbjct  240   PRGCSNGGTCQLMPEKDSTFHLCLCPPGFIGP----------DCEVNPDNCVSHQCQNGG  289

Query  1137  ------GSFICHCQLGYSVKKGTTGCTDVDECEI-GAHNCDMHASCVNVPGSFKCSCREG  1189
                    ++ C C   ++   G     DVDECE  G  +C    +C N  GSF C C  G
Sbjct  290   TCQDGLDTYTCLCPETWT---GWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSG  346

Query  1190  WVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDEC-AENV  1248
             W G   +  +LD+C   T  C+  + C++  GS+ C C  G TG    C   D C ++  
Sbjct  347   WGGTSCE-ENLDDCIAAT--CAPGSTCIDRVGSFSCLCPPGRTG--LLCHLEDMCLSQPC  401

Query  1249  HLCENGQCLNVP--GAYRCECEMGFTPASDSKSCQDINECSFQNICVF-----GTCNNLP  1301
             H   + QC   P  G+  C C+ G+   S     QD++EC             G+C N P
Sbjct  402   H--GDAQCSTNPLTGSTLCLCQPGY---SGPTCHQDLDECLMAQQGPSPCEHGGSCLNTP  456

Query  1302  GMFHCICDDGYELDRTGGNC-TDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGV  1360
             G F+C+C  GY    TG  C  D +EC          C++    + C CPP         
Sbjct  457   GSFNCLCPPGY----TGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGL-------  505

Query  1361  GCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEY  1420
                               +G L C  E                   N C + P +N  + 
Sbjct  506   ------------------EGQL-CEVET------------------NECASAPCLNHADC  528

Query  1421  NTLCPGGE-----GFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLS  1475
             + L  G +     GF     T   EDIDEC+  P    GG C +  G+F C+C  G+   
Sbjct  529   HDLLNGFQCICLPGFS---GTRCEEDIDECRSSP-CANGGQCQDQPGAFHCKCLPGF---  581

Query  1476  EETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSY  1535
             E  R   ++DEC++ P   G  +C +  G + C+                     C   +
Sbjct  582   EGPRCQTEVDECLSDPCPVG-ASCLDLPGAFFCL---------------------CPSGF  619

Query  1536  NGTSCENEL-PFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGF------  1588
              G  CE  L   N+ +    C     KA N  C P  +PG A  ++ C    G       
Sbjct  620   TGQLCEVPLCAPNLCQPKQICKDQKDKA-NCLC-PDGSPGCAPPEDNCTCHHGHCQRSSC  677

Query  1589  TFDI-HSGKAVDIDECKEIPGICANG-VCINQIGSFRCECPTGFSYNDLLLVCEDIDECS  1646
               D+  +G   + +    I   CA+G  C  Q   + C CPTG++        E++  C 
Sbjct  678   VCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTGYTGP---TCSEEMTACH  734

Query  1647  NGDNL------------------------CQRNAD------------CINSPGSYRCECA  1670
             +G  L                        CQ + D            C+N PG++ C CA
Sbjct  735   SGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGGTCVNRPGTFSCLCA  794

Query  1671  AGFKLSPNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECE  1730
              GF+  P      R  C + P   +   C D     +C+C  G+     QT+   +D C 
Sbjct  795   MGFQ-GPRCEGKLRPSCADSPCR-NRATCQDSPQGPRCLCPTGYTGGSCQTL---MDLCA  849

Query  1731  RHPCG-NGTCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSF-------FGQVCRNG-RC  1781
             + PC  N  C  T  S++CLC  G+     N  + +  C             +C NG  C
Sbjct  850   QKPCPRNSHCLQTGPSFHCLCLQGWTGPLCN--LPLSSCQKAALSQGIDVSSLCHNGGLC  907

Query  1782  FNEIGSFKCLCNEGYELTLDGKNCID-TNECVALPGSCSPG-TCQNLEGSFRCICPPGYE  1839
              +   S+ C C  G++ +L    C D  N C + P  C  G TC      + C C PGY+
Sbjct  908   VDSGPSYFCHCPPGFQGSL----CQDHVNPCESRP--CQNGATCMAQPSGYLCQCAPGYD  961

Query  1840  VKSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFV  1879
              ++ S  +++ C   P     G+CT  PGGF C CP GFV
Sbjct  962   GQNCS-KELDACQSQP-CHNHGTCTPKPGGFHCACPPGFV  999


 Score = 140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 279/1072 (26%), Positives = 400/1072 (37%), Gaps = 281/1072 (26%)

Query  1041  NGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCL  1100
              G CH     + G  +CSC  G+        C   D C +NP + +GG C     + +C 
Sbjct  130   RGRCHI---QASGRPQCSCMPGWT----GEQCQLRDFCSANPCV-NGGVCLATYPQIQCH  181

Query  1101  CYDGFMASMDMKTCIDVNECDLNSNICMFG-ECENTKGSFICHCQLGYS-----VKKGT-  1153
             C  GF      +   DVNEC  +   C  G  C NT GSF C C +G       ++ G  
Sbjct  182   CPPGFEGHACER---DVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPC  238

Query  1154  --TGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCS  1211
                GC++   C++          C+  PG     C           ++ D C   +HQC 
Sbjct  239   PPRGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCE----------VNPDNCV--SHQCQ  286

Query  1212  VNAQCVNSPGSYLCACVEGFTGDGFTCS-DVDEC-AENVHLCENGQCLNVPGAYRCECEM  1269
                 C +   +Y C C E +TG  + CS DVDEC  +    C NG               
Sbjct  287   NGGTCQDGLDTYTCLCPETWTG--WDCSEDVDECETQGPPHCRNG---------------  329

Query  1270  GFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTD-VDECA  1328
                                      GTC N  G FHC+C  G+     G +C + +D+C 
Sbjct  330   -------------------------GTCQNSAGSFHCVCVSGW----GGTSCEENLDDCI  360

Query  1329  DPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEI  1388
                      C++  G + C CPP      TG+ C    + +  L     GD   S N   
Sbjct  361   AATCAPGSTCIDRVGSFSCLCPPGR----TGLLC---HLEDMCLSQPCHGDAQCSTNPLT  413

Query  1389  GVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNPITIILEDIDEC---  1445
             G  +    C C  G + G  C                              +D+DEC   
Sbjct  414   GSTL----CLCQPGYS-GPTCH-----------------------------QDLDECLMA  439

Query  1446  QELPGLCQ-GGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPG-TCYNTL  1503
             Q+ P  C+ GG+C+NT GSF C CP GY  S   R   D +EC++ P  C PG TC + L
Sbjct  440   QQGPSPCEHGGSCLNTPGSFNCLCPPGYTGS---RCEADHNECLSQP--CHPGSTCLDLL  494

Query  1504  GNYTCICPPEY------MQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTY  1557
               + C+CPP        ++ N   +   +  + C+   NG                    
Sbjct  495   ATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNG--------------------  534

Query  1558  NVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICANG-VCI  1616
                                 F+ IC  +PGF+    +    DIDEC+  P  CANG  C 
Sbjct  535   --------------------FQCIC--LPGFS---GTRCEEDIDECRSSP--CANGGQCQ  567

Query  1617  NQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLS  1676
             +Q G+F C+C  GF          ++DEC +  + C   A C++ PG++ C C +GF   
Sbjct  568   DQPGAFHCKCLPGFEGPRCQT---EVDECLS--DPCPVGASCLDLPGAFFCLCPSGF---  619

Query  1677  PNGACVDRNECLEIPNVCS-HGLCVDMQGSYKCICHNGFKA---SQDQTMC---------  1723
               G   +   C   PN+C    +C D +    C+C +G       +D   C         
Sbjct  620   -TGQLCEVPLC--APNLCQPKQICKDQKDKANCLCPDGSPGCAPPEDNCTCHHGHCQRSS  676

Query  1724  -------------MDVDECERHPCGNG-TCKNTVGSYNCLCYPGFELTHNNDCMDIDECS  1769
                           ++  C   PC +G TC      YNC C  G+  T      ++  C 
Sbjct  677   CVCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTGY--TGPTCSEEMTACH  734

Query  1770  SFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNC-IDTNECVALPGSCSPGTCQNLEG  1828
             S  G     G C    G + C C   +     G  C   T+ CV+ P   + GTC N  G
Sbjct  735   S--GPCLNGGSCNPSPGGYYCTCPPSHT----GPQCQTSTDYCVSAP-CFNGGTCVNRPG  787

Query  1829  SFRCICPPGYEVKSESCIDINECNEDPNICL-FGSCTNTPGGFQCICPTGFV------LS  1881
             +F C+C  G++           C + P  C    +C ++P G +C+CPTG+       L 
Sbjct  788   TFSCLCAMGFQGPRCEGKLRPSCADSP--CRNRATCQDSPQGPRCLCPTGYTGGSCQTLM  845

Query  1882  D--------NGRRCFDTRQSF---CFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDP  1930
             D            C  T  SF   C   +    C++P +         C K       D 
Sbjct  846   DLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSS--------CQKAALSQGIDV  897

Query  1931  CELCPK-----EEEVAFQDLCPYG-HGTIPGIDDTREDVNECLESPGVCSNGH-CINTDG  1983
               LC       +   ++   CP G  G++      ++ VN C   P  C NG  C+    
Sbjct  898   SSLCHNGGLCVDSGPSYFCHCPPGFQGSL-----CQDHVNPCESRP--CQNGATCMAQPS  950

Query  1984  SFRCECPMGYNLDYTGVHCIDTDECSIGNPCGN-GTCTNVIGSFECNCHEGF  2034
              + C+C  GY+    G +C    +     PC N GTCT   G F C C  GF
Sbjct  951   GYLCQCAPGYD----GQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGF  998


 Score = 132 bits (333),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 194/672 (29%), Positives = 280/672 (42%), Gaps = 131/672 (19%)

Query  1454  GGNCINTFGSFQCECPKGYYLSEETRICE-DIDECVAHPGVCGPGT-CYNTLGNYTCIC-  1510
             GG C+ T+   QC CP G+    E   CE D++EC   PG C  GT C+NTLG++ C+C 
Sbjct  168   GGVCLATYPQIQCHCPPGF----EGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCP  223

Query  1511  ---------------PPEYMQVNGGHNCMDMRKS-----FCYRSYNGTSCENELPFNVTK  1550
                            PP      G    M  + S      C   + G  CE   P N   
Sbjct  224   VGQEGPRCELRAGPCPPRGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVN-PDNCVS  282

Query  1551  RMC--------------CCTYNVGKAWN--KPCEPCPTPGTAEFKN--ICGNIPG-FTFD  1591
               C              C        W+  +  + C T G    +N   C N  G F   
Sbjct  283   HQCQNGGTCQDGLDTYTCLCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCV  342

Query  1592  IHSGKA-----VDIDECKEIPGICANG-VCINQIGSFRCECPTGFSYNDLLLVCEDIDEC  1645
               SG        ++D+C  I   CA G  CI+++GSF C CP G +     L+C   D C
Sbjct  343   CVSGWGGTSCEENLDDC--IAATCAPGSTCIDRVGSFSCLCPPGRTG----LLCHLEDMC  396

Query  1646  SNGDNLCQRNADCINSP--GSYRCECAAGFKLSPNGACVDRNECL---EIPNVCSHG-LC  1699
              +    C  +A C  +P  GS  C C  G+  S      D +ECL   + P+ C HG  C
Sbjct  397   LS--QPCHGDAQCSTNPLTGSTLCLCQPGY--SGPTCHQDLDECLMAQQGPSPCEHGGSC  452

Query  1700  VDMQGSYKCICHNGFKASQDQTMCMDVDECERHPCGNG-TCKNTVGSYNCLCYPGFELTH  1758
             ++  GS+ C+C  G+  S+ +    D +EC   PC  G TC + + +++CLC PG E   
Sbjct  453   LNTPGSFNCLCPPGYTGSRCEA---DHNECLSQPCHPGSTCLDLLATFHCLCPPGLE---  506

Query  1759  NNDC-MDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCI-DTNECVALPG  1816
                C ++ +EC+S       +  C + +  F+C+C  G+     G  C  D +EC + P 
Sbjct  507   GQLCEVETNECAS--APCLNHADCHDLLNGFQCICLPGF----SGTRCEEDIDECRSSPC  560

Query  1817  SCSPGTCQNLEGSFRCICPPGYEVKSESCIDINECNEDPNICLFG-SCTNTPGGFQCICP  1875
             + + G CQ+  G+F C C PG+E       +++EC  DP  C  G SC + PG F C+CP
Sbjct  561   A-NGGQCQDQPGAFHCKCLPGFE-GPRCQTEVDECLSDP--CPVGASCLDLPGAFFCLCP  616

Query  1876  TGFV------------LSDNGRRCFDTR-QSFCFTNFENGKCSVPKAFNT------TKAK  1916
             +GF             L    + C D + ++ C     +  C+ P+   T       ++ 
Sbjct  617   SGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAPPEDNCTCHHGHCQRSS  676

Query  1917  CCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGID------DTREDVNECLESP  1970
             C C      GW  P   C  E        C +G    P          T      C E  
Sbjct  677   CVCDV----GWTGP--ECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTGYTGPTCSEEM  730

Query  1971  GVCSNGHCIN------TDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGNG-TCTNVI  2023
               C +G C+N      + G + C CP      +TG  C  + +  +  PC NG TC N  
Sbjct  731   TACHSGPCLNGGSCNPSPGGYYCTCPP----SHTGPQCQTSTDYCVSAPCFNGGTCVNRP  786

Query  2024  GSFECNCHEGFE  2035
             G+F C C  GF+
Sbjct  787   GTFSCLCAMGFQ  798


 Score = 120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 268/988 (27%), Positives = 389/988 (39%), Gaps = 247/988 (25%)

Query  1203  CSNGTHQCSVNAQCVN-SPGSYLCACVEGFTGDGFTCSDVDECAENVHLCENG----QCL  1257
             C +    C+    C++ S G   C C  GF G+  TC   D C +N  LC+NG      L
Sbjct  28    CGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGE--TCQFPDPC-QNAQLCQNGGSCQALL  84

Query  1258  NVP-----------GAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCN-NLPGMFH  1305
               P            ++ C C  GFT        +D    SF      G C+    G   
Sbjct  85    PAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAKLEDPCPPSF--CSKRGRCHIQASGRPQ  142

Query  1306  CICDDGYELDRTGGNCTDVDEC-ADPINCVNG-LCVNTPGRYECNCPPDFQLNPTGVGCV  1363
             C C  G+    TG  C   D C A+P  CVNG +C+ T  + +C+CPP F+    G  C 
Sbjct  143   CSCMPGW----TGEQCQLRDFCSANP--CVNGGVCLATYPQIQCHCPPGFE----GHAC-  191

Query  1364  DNRVGNCYLKYGPRGDGSLSCNTEIG-------VGVS------RSSCCCSLGKAWGNPCE  1410
             +  V  C+   GP   G+ SC+  +G       VG        R+  C   G + G  C+
Sbjct  192   ERDVNECFQDPGPCPKGT-SCHNTLGSFQCLCPVGQEGPRCELRAGPCPPRGCSNGGTCQ  250

Query  1411  TCPPVNSTEYNTLCPGG---EGFRPNPITIIL----------------------------  1439
               P  +ST +  LCP G        NP   +                             
Sbjct  251   LMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTCLCPETWTGWD  310

Query  1440  --EDIDECQ-ELPGLCQ-GGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCG  1495
               ED+DEC+ + P  C+ GG C N+ GSF C C  G+     T   E++D+C+A    C 
Sbjct  311   CSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGW---GGTSCEENLDDCIA--ATCA  365

Query  1496  PG-TCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMCC  1554
             PG TC + +G+++C+CPP                        G  C  E        MC 
Sbjct  366   PGSTCIDRVGSFSCLCPP---------------------GRTGLLCHLE-------DMCL  397

Query  1555  CTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDI-HSGKAVDIDEC---KEIPGIC  1610
                  G A    C   P  G+     +C   PG++    H     D+DEC   ++ P  C
Sbjct  398   SQPCHGDAQ---CSTNPLTGS----TLCLCQPGYSGPTCHQ----DLDECLMAQQGPSPC  446

Query  1611  ANG-VCINQIGSFRCECPTGFSYNDLLLVCE-DIDECSNGDNLCQRNADCINSPGSYRCE  1668
              +G  C+N  GSF C CP G++ +     CE D +EC +    C   + C++   ++ C 
Sbjct  447   EHGGSCLNTPGSFNCLCPPGYTGSR----CEADHNECLS--QPCHPGSTCLDLLATFHCL  500

Query  1669  CAAGFKLSPNGAC-VDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVD  1727
             C  G +      C V+ NEC   P + +H  C D+   ++CIC  GF  ++ +    D+D
Sbjct  501   CPPGLE---GQLCEVETNECASAPCL-NHADCHDLLNGFQCICLPGFSGTRCEE---DID  553

Query  1728  ECERHPCGNG-TCKNTVGSYNCLCYPGFE----LTHNNDCMD---------IDECSSFF-  1772
             EC   PC NG  C++  G+++C C PGFE     T  ++C+          +D   +FF 
Sbjct  554   ECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGAFFC  613

Query  1773  -------GQVCR-----------NGRCFNEIGSFKCLCNEGY------------------  1796
                    GQ+C               C ++     CLC +G                   
Sbjct  614   LCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAPPEDNCTCHHGHCQ  673

Query  1797  ------ELTLDGKNC-IDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSESCIDIN  1849
                   ++   G  C  +   C++ P +   GTC      + C CP GY   + S  ++ 
Sbjct  674   RSSCVCDVGWTGPECEAELGGCISAPCAHG-GTCYPQPSGYNCTCPTGYTGPTCS-EEMT  731

Query  1850  ECNEDPNICL-FGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTN--FENGKC-S  1905
              C+  P  CL  GSC  +PGG+ C CP     S  G +C  T   +C +   F  G C +
Sbjct  732   ACHSGP--CLNGGSCNPSPGGYYCTCPP----SHTGPQC-QTSTDYCVSAPCFNGGTCVN  784

Query  1906  VPKAFNTTKAKCCCSKMPG---EGWGDP-CELCPKEEEVAFQD-------LCPYGHGTIP  1954
              P  F+      C     G   EG   P C   P       QD       LCP G+    
Sbjct  785   RPGTFSCL----CAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTG--  838

Query  1955  GIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPMGY-----NLDYTGVHCIDTDE-C  2008
             G   T  D+  C + P    N HC+ T  SF C C  G+     NL  +        +  
Sbjct  839   GSCQTLMDL--CAQKP-CPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGI  895

Query  2009  SIGNPCGNG-TCTNVIGSFECNCHEGFE  2035
              + + C NG  C +   S+ C+C  GF+
Sbjct  896   DVSSLCHNGGLCVDSGPSYFCHCPPGFQ  923


> sp|P23142|FBLN1_HUMAN Fibulin-1 OS=Homo sapiens GN=FBLN1 PE=1 
SV=4
Length=703

 Score = 167 bits (422),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 142/450 (32%), Positives = 212/450 (47%), Gaps = 44/450 (10%)

Query  922   CVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCR-GGTCVNTEGSFQCD----C  976
             C +T     C CF GY+       +C D++EC      CR G +C+NT GSF+C     C
Sbjct  190   CRDTGDEVVCSCFVGYQL-LSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSC  248

Query  977   PLGHELSPSREECIDVNECSLSDSLCR-NGKCVNMVGTYQC----SCNSGYQATPDRRSC  1031
               G+EL+     C D++EC      C  +  C N +G+++C     C SG+       +C
Sbjct  249   GTGYELTED-NSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGF-IQDALGNC  306

Query  1032  TDIDECMIMNGGC---HTHCTNSEGSYECS-----CSDGYALMPDVRTCADIDECESNPD  1083
              DI+EC+ ++  C   HT C N+EGSY C      C  GY L  +   C D+DEC    +
Sbjct  307   IDINECLSISAPCPIGHT-CINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAE  365

Query  1084  IC-DGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICH  1142
              C  G +C N PG +RC C  G+      + C+DVNEC          +CENT GS++C 
Sbjct  366   PCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLGSYLCS  425

Query  1143  CQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWV---GNGIKCID  1199
             C +G+ +      C D++EC   +  C     C NV GS++C CR G+     +G+ C D
Sbjct  426   CSVGFRLSVDGRSCEDINEC--SSSPCSQ--ECANVYGSYQCYCRRGYQLSDVDGVTCED  481

Query  1200  LDECS--NGTHQCSVNAQCVNSPGSYLCACVEG---FTGDGFTCSDVDECAENVHLCE-N  1253
             +DEC+   G H CS   +C+N PGS+ C+C         +G  C D+DEC   +H C  N
Sbjct  482   IDECALPTGGHICSY--RCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSIN  539

Query  1254  GQCLNVPGAYRCECEMGFT-PASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGY  1312
               C N+ G +RC   + F  P +  +S   + +     +    +C   P    C+ D  +
Sbjct  540   ETCFNIQGGFRC---LAFECPENYRRSAATLQQEKTDTVRCIKSCR--PNDVTCVFDPVH  594

Query  1313  ELDRTGGNCTDVDECADPINCVNGLCVNTP  1342
              +  T  +     E   P   +    +  P
Sbjct  595   TISHTVISLPTFREFTRPEEIIFLRAITPP  624


 Score = 164 bits (416),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 121/346 (35%), Positives = 178/346 (51%), Gaps = 27/346 (8%)

Query  1042  GGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQ-CTNIPGEYRCL  1100
             G C   C ++     CSC  GY L+ D  +C D++EC +    C  G+ C N  G +RC 
Sbjct  184   GPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQ  243

Query  1101  ----CYDGFMASMDMKTCIDVNECDLNSNICMFG-ECENTKGSFIC----HCQLGYSVKK  1151
                 C  G+  + D  +C D++EC+   + C+    C+NT GSF C     C+ G+ ++ 
Sbjct  244   RDSSCGTGYELTED-NSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGF-IQD  301

Query  1152  GTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCS-----CREGWVGN--GIKCIDLDECS  1204
                 C D++EC   +  C +  +C+N  GS+ C      C  G+  N  G +C+D+DEC+
Sbjct  302   ALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECA  361

Query  1205  NGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFT--CSDVDECAENVHLCENGQCLNVPGA  1262
                  C    +CVNSPGS+ C C  G+  DG +  C DV+EC          +C N  G+
Sbjct  362   PPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLGS  421

Query  1263  YRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYEL-DRTGGNC  1321
             Y C C +GF  + D +SC+DINECS         C N+ G + C C  GY+L D  G  C
Sbjct  422   YLCSCSVGFRLSVDGRSCEDINECSSSP--CSQECANVYGSYQCYCRRGYQLSDVDGVTC  479

Query  1322  TDVDECADPI--NCVNGLCVNTPGRYECNCPPD-FQLNPTGVGCVD  1364
              D+DECA P   +  +  C+N PG ++C+CP   ++L P G  C D
Sbjct  480   EDIDECALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQD  525


 Score = 160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 151/456 (33%), Positives = 214/456 (47%), Gaps = 67/456 (15%)

Query  1441  DIDECQELPGL---CQGG-----NCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPG  1492
             +++E QE P L   C+GG      C +T     C C  GY L  +   CED++EC+    
Sbjct  166   EVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSH  225

Query  1493  VCGPG-TCYNTLGNYTC----ICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFN  1547
              C  G +C NT+G++ C     C   Y ++   ++C D+ +         +   N LP  
Sbjct  226   SCRLGESCINTVGSFRCQRDSSCGTGY-ELTEDNSCKDIDEC-------ESGIHNCLPDF  277

Query  1548  VTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIP  1607
             +      C   +G    +P   C +              GF  D   G  +DI+EC  I 
Sbjct  278   I------CQNTLGSFRCRPKLQCKS--------------GFIQDA-LGNCIDINECLSIS  316

Query  1608  GICANG-VCINQIGSFRCE-----CPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINS  1661
               C  G  CIN  GS+ C+     C  G+  N+    C D+DEC+     C +   C+NS
Sbjct  317   APCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNS  376

Query  1662  PGSYRCECAAGFKLS-PNGACVDRNECLEIP-NVCSHGLCVDMQGSYKCICHNGFKASQD  1719
             PGS+RCEC  G+     +  CVD NEC   P  +C H  C +  GSY C C  GF+ S D
Sbjct  377   PGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHK-CENTLGSYLCSCSVGFRLSVD  435

Query  1720  QTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNN--DCMDIDECSSFFGQVCR  1777
                C D++EC   PC    C N  GSY C C  G++L+  +   C DIDEC+   G    
Sbjct  436   GRSCEDINECSSSPCSQ-ECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHIC  494

Query  1778  NGRCFNEIGSFKCLC-NEGYELTLDGKNCIDTNECVALPGSCSPG-TCQNLEGSFRCI--  1833
             + RC N  GSF+C C + GY L  +G+NC D +ECV    +CS   TC N++G FRC+  
Sbjct  495   SYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAF  554

Query  1834  -CPPGY--------EVKSESCIDINECNEDPNICLF  1860
              CP  Y        + K+++   I  C  +   C+F
Sbjct  555   ECPENYRRSAATLQQEKTDTVRCIKSCRPNDVTCVF  590


 Score = 147 bits (371),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 115/296 (39%), Positives = 157/296 (53%), Gaps = 22/296 (7%)

Query  863   KDINECKVFPGMCM-NGKCRNTIGSFKCK----CNSGFTLDMEERNCTDIDECWISPDLC  917
             KDI+EC+     C+ +  C+NT+GSF+C+    C SGF  D    NC DI+EC      C
Sbjct  261   KDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALG-NCIDINECLSISAPC  319

Query  918   GSG-TCVNTPGSFECE-----CFDGYESGFMMMKNCMDIDECERNPLLC-RGGTCVNTEG  970
               G TC+NT GS+ C+     C  GY       + C+D+DEC      C +G  CVN+ G
Sbjct  320   PIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTR-CVDVDECAPPAEPCGKGHRCVNSPG  378

Query  971   SFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRS  1030
             SF+C+C  G+        C+DVNEC          KC N +G+Y CSC+ G++ + D RS
Sbjct  379   SFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLGSYLCSCSVGFRLSVDGRS  438

Query  1031  CTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMP-DVRTCADIDECE--SNPDICDG  1087
             C DI+EC   +  C   C N  GSY+C C  GY L   D  TC DIDEC   +   IC  
Sbjct  439   CEDINEC--SSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHIC-S  495

Query  1088  GQCTNIPGEYRCLC-YDGFMASMDMKTCIDVNECDLNSNICMFGE-CENTKGSFIC  1141
              +C NIPG ++C C   G+  + + + C D++EC    + C   E C N +G F C
Sbjct  496   YRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRC  551


 Score = 142 bits (359),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 135/417 (32%), Positives = 182/417 (44%), Gaps = 74/417 (18%)

Query  1131  ECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGW  1190
             +C +T    +C C +GY +      C DV+EC  G+H+C +  SC+N  GSF+C  R+  
Sbjct  189   QCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQ-RDSS  247

Query  1191  VGNGIK------CIDLDECSNGTHQCSVNAQCVNSPGSYLC----ACVEGFTGDGF-TCS  1239
              G G +      C D+DEC +G H C  +  C N+ GS+ C     C  GF  D    C 
Sbjct  248   CGTGYELTEDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCI  307

Query  1240  DVDECAENVHLCENGQ-CLNVPGAYRCE-----CEMGFTPASDSKSCQDINECS-FQNIC  1292
             D++EC      C  G  C+N  G+Y C+     C  G+    +   C D++EC+     C
Sbjct  308   DINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPC  367

Query  1293  VFG-TCNNLPGMFHCICDDGYELDRTGGNCTDVDECAD-PINCVNGLCVNTPGRYECNCP  1350
               G  C N PG F C C  GY  D     C DV+EC   P       C NT G Y C+C 
Sbjct  368   GKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLGSYLCSCS  427

Query  1351  PDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCE  1410
               F+L+  G  C D  +  C                      S S C       +G+   
Sbjct  428   VGFRLSVDGRSCED--INEC----------------------SSSPCSQECANVYGS---  460

Query  1411  TCPPVNSTEYNTLCPGGEGFRPNPIT-IILEDIDECQELPGLCQGGN-----CINTFGSF  1464
                      Y   C    G++ + +  +  EDIDEC     L  GG+     CIN  GSF
Sbjct  461   ---------YQCYCR--RGYQLSDVDGVTCEDIDEC----ALPTGGHICSYRCINIPGSF  505

Query  1465  QCECP-KGYYLSEETRICEDIDECVAHPGVCGPG-TCYNTLGNYTCI---CPPEYMQ  1516
             QC CP  GY L+   R C+DIDECV     C    TC+N  G + C+   CP  Y +
Sbjct  506   QCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPENYRR  562


 Score = 139 bits (351),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 131/409 (32%), Positives = 182/409 (44%), Gaps = 60/409 (15%)

Query  1624  CECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCE----CAAGFKLSPNG  1679
             C C  G+      + CED++EC  G + C+    CIN+ GS+RC+    C  G++L+ + 
Sbjct  199   CSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELTEDN  258

Query  1680  ACVDRNECLE-IPNVCSHGLCVDMQGSYKCI----CHNGFKASQDQT-MCMDVDECER--  1731
             +C D +EC   I N     +C +  GS++C     C +GF   QD    C+D++EC    
Sbjct  259   SCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGF--IQDALGNCIDINECLSIS  316

Query  1732  HPCGNG-TCKNTVGSYNCL-----CYPGFELTHN-NDCMDIDECSSFFGQVCRNGRCFNE  1784
              PC  G TC NT GSY C      C  G+ L      C+D+DEC+       +  RC N 
Sbjct  317   APCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNS  376

Query  1785  IGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYE--VKS  1842
              GSF+C C  GY      + C+D NEC   PG      C+N  GS+ C C  G+   V  
Sbjct  377   PGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLGSYLCSCSVGFRLSVDG  436

Query  1843  ESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSD-NGRRCFDTRQSFCFTNFEN  1901
              SC DINEC+  P       C N  G +QC C  G+ LSD +G  C D            
Sbjct  437   RSCEDINECSSSP---CSQECANVYGSYQCYCRRGYQLSDVDGVTCEDI-----------  482

Query  1902  GKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTRE  1961
              +C++P   +    +C    +PG                +FQ  CP     +       +
Sbjct  483   DECALPTGGHICSYRCI--NIPG----------------SFQCSCPSSGYRLAPNGRNCQ  524

Query  1962  DVNECLESPGVCS-NGHCINTDGSFRC---ECPMGYNLDYTGVHCIDTD  2006
             D++EC+     CS N  C N  G FRC   ECP  Y      +    TD
Sbjct  525   DIDECVTGIHNCSINETCFNIQGGFRCLAFECPENYRRSAATLQQEKTD  573


 Score = 139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 131/373 (35%), Positives = 171/373 (46%), Gaps = 66/373 (18%)

Query  297  LNGRCIPTLSSYRCE----CNMGYKQDSNGDCTDVDECTS---NPCSNGDCVNTPGSYYC  349
            L   CI T+ S+RC+    C  GY+   +  C D+DEC S   N   +  C NT GS+ C
Sbjct  229  LGESCINTVGSFRCQRDSSCGTGYELTEDNSCKDIDECESGIHNCLPDFICQNTLGSFRC  288

Query  350  K----CHAGFQRTPTKQACIDIDECIQNGVLCKNGR-CVNTDGSFQCI-----CNAGFEL  399
            +    C +GF +      CIDI+EC+     C  G  C+NT+GS+ C      C  G+ L
Sbjct  289  RPKLQCKSGFIQDALGN-CIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHL  347

Query  400  TTDGKNCVDHDECT-TTNMCLNG-MCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTSG  457
              +G  CVD DEC      C  G  C+N  GSF+C CK G+      R C D++ECQ   
Sbjct  348  NEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYP  407

Query  458  ICMNGH-CINTEGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTK  516
              + GH C NT GS+ C C  G  + VDGR C D +  S+                    
Sbjct  408  GRLCGHKCENTLGSYLCSCSVGFRLSVDGRSCEDINECSS--------------------  447

Query  517  SECCCANPDYGFGEPCHPCPAKNSAEFHGLCSSGIGIT-VDG---RDINECALDP--DIC  570
                          PC    A     +   C  G  ++ VDG    DI+ECAL     IC
Sbjct  448  -------------SPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHIC  494

Query  571  SNGICENLRGSYRCNC-NSGYEPDPSGRNCVDIDECSVNRLLCD-NGLCRNTPGSYSCT-  627
            S   C N+ GS++C+C +SGY   P+GRNC DIDEC      C  N  C N  G + C  
Sbjct  495  SYR-CINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLA  553

Query  628  --CPKGYVFSTET  638
              CP+ Y  S  T
Sbjct  554  FECPENYRRSAAT  566


 Score = 135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 127/365 (35%), Positives = 162/365 (44%), Gaps = 61/365 (17%)

Query  1699  CVDMQGSYKCICHNGFKASQDQTMCMDVDECE--RHPCGNG-TCKNTVGSYNCL----CY  1751
             C D      C C  G++   D   C DV+EC    H C  G +C NTVGS+ C     C 
Sbjct  190   CRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCG  249

Query  1752  PGFELTHNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCL----CNEGYELTLDGKNCID  1807
              G+ELT +N C DIDEC S       +  C N +GSF+C     C  G+     G NCID
Sbjct  250   TGYELTEDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALG-NCID  308

Query  1808  TNECVALPGSCSPG-TCQNLEGSFRCI-----CPPGYEVKSE--SCIDINECNEDPNICL  1859
              NEC+++   C  G TC N EGS+ C      C  GY +  E   C+D++EC      C 
Sbjct  309   INECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCG  368

Query  1860  FG-SCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCC  1918
              G  C N+PG F+C C TG+      R C D  +                          
Sbjct  369   KGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNE--------------------------  402

Query  1919  CSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTR-EDVNECLESPGVCSNGH  1977
             C + PG   G  CE            LC    G    +D    ED+NEC  SP  CS   
Sbjct  403   CQRYPGRLCGHKCE------NTLGSYLCSCSVGFRLSVDGRSCEDINECSSSP--CSQ-E  453

Query  1978  CINTDGSFRCECPMGYNL-DYTGVHCIDTDECSI--GNPCGNGTCTNVIGSFECNC-HEG  2033
             C N  GS++C C  GY L D  GV C D DEC++  G    +  C N+ GSF+C+C   G
Sbjct  454   CANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQCSCPSSG  513

Query  2034  FEPGP  2038
             +   P
Sbjct  514   YRLAP  518


 Score = 124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 134/379 (35%), Positives = 172/379 (45%), Gaps = 67/379 (18%)

Query  334  PCSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGR-CVNTDGSFQC-  391
            PC    C +T     C C  G+Q      +C D++ECI     C+ G  C+NT GSF+C 
Sbjct  185  PCKQ-QCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQ  243

Query  392  ---ICNAGFELTTDGKNCVDHDECTT-TNMCL-NGMCINEDGSFKC----ICKPGFVLAP  442
                C  G+ELT D  +C D DEC +  + CL + +C N  GSF+C     CK GF+   
Sbjct  244  RDSSCGTGYELTED-NSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDA  302

Query  443  NGRYCTDIDECQT-SGICMNGH-CINTEGSFRCE-----CPPGLAVGVDGRVCVDTHMRS  495
             G  C DI+EC + S  C  GH CINTEGS+ C+     C  G  +  +G  CVD     
Sbjct  303  LGN-CIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDE--  359

Query  496  TCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPC---HPCPAKNSAEFHGLCSSGI-  551
                                     CA P     EPC   H C   +   F   C +G  
Sbjct  360  -------------------------CAPP----AEPCGKGHRC-VNSPGSFRCECKTGYY  389

Query  552  --GITVDGRDINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDIDECSVNR  609
              GI+    D+NEC   P       CEN  GSY C+C+ G+     GR+C DI+ECS + 
Sbjct  390  FDGISRMCVDVNECQRYPGRLCGHKCENTLGSYLCSCSVGFRLSVDGRSCEDINECSSSP  449

Query  610  LLCDNGLCRNTPGSYSCTCPKGYVFS-TETDTCEDINECE---SSPCVNGACRNNLGSFN  665
                +  C N  GSY C C +GY  S  +  TCEDI+EC         +  C N  GSF 
Sbjct  450  C---SQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQ  506

Query  666  CEC-SPGSKLDSTGLICID  683
            C C S G +L   G  C D
Sbjct  507  CSCPSSGYRLAPNGRNCQD  525


 Score = 120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 129/426 (30%), Positives = 180/426 (42%), Gaps = 80/426 (19%)

Query  637   ETDTCEDINECESSPCVN----------GACRNNLGSFNCECSPGSKLDSTGLICIDSLK  686
             ETD   ++ E +  P +N            CR+      C C  G +L S G+ C D   
Sbjct  160   ETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDV--  217

Query  687   GTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVNGVTCED  746
                      + C    +   L   C  T+G+       RC+ D++C  G+      +C+D
Sbjct  218   ---------NECITGSHSCRLGESCINTVGSF------RCQRDSSCGTGYELTEDNSCKD  262

Query  747   VNECDVFPGVC-PNGRCINSRGSFHC----ECPEGLTLDGTGRVCLDIRM----------  791
             ++EC+     C P+  C N+ GSF C    +C  G   D  G  C+DI            
Sbjct  263   IDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGN-CIDINECLSISAPCPI  321

Query  792   -EQCYLTWDEDECIRSVPGKFRMDACCCAVGAAWGS------DCEECPKPDTK-EYEALC  843
                C  T     C ++VP         C  G           D +EC  P         C
Sbjct  322   GHTCINTEGSYTCQKNVPN--------CGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRC  373

Query  844   PRGPGFSNRGDILTGRPFY------KDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTL  897
                PG S R +  TG  F        D+NEC+ +PG     KC NT+GS+ C C+ GF L
Sbjct  374   VNSPG-SFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLGSYLCSCSVGFRL  432

Query  898   DMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNP  957
              ++ R+C DI+EC  SP    S  C N  GS++C C  GY+   +    C DIDEC    
Sbjct  433   SVDGRSCEDINECSSSP---CSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDEC----  485

Query  958   LLCRGG-----TCVNTEGSFQCDCP-LGHELSPSREECIDVNECSLSDSLCR-NGKCVNM  1010
              L  GG      C+N  GSFQC CP  G+ L+P+   C D++EC      C  N  C N+
Sbjct  486   ALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNI  545

Query  1011  VGTYQC  1016
              G ++C
Sbjct  546   QGGFRC  551


 Score = 114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 136/416 (33%), Positives = 182/416 (44%), Gaps = 67/416 (16%)

Query  381  RCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMC--LNGMCINEDGSFKCI----C  434
            +C +T     C C  G++L +DG +C D +EC T +    L   CIN  GSF+C     C
Sbjct  189  QCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSC  248

Query  435  KPGFVLAPNGRYCTDIDECQTSGI--CM-NGHCINTEGSFRCECPPGLAVGVDGRVCVDT  491
              G+ L  +   C DIDEC+ SGI  C+ +  C NT GSFRC   P L            
Sbjct  249  GTGYELTEDNS-CKDIDECE-SGIHNCLPDFICQNTLGSFRCR--PKLQ-----------  293

Query  492  HMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGL-CSSG  550
                 C  G  + A        +  +EC   +     G  C       + + +   C  G
Sbjct  294  -----CKSGFIQDA----LGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRG  344

Query  551  IGITVDGR---DINECALDPDICSNG-ICENLRGSYRCNCNSGYEPDPSGRNCVDIDECS  606
              +  +G    D++ECA   + C  G  C N  GS+RC C +GY  D   R CVD++EC 
Sbjct  345  YHLNEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQ  404

Query  607  VNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINECESSPCVNGACRNNLGSFNC  666
                      C NT GSY C+C  G+  S +  +CEDINEC SSPC +  C N  GS+ C
Sbjct  405  RYPGRLCGHKCENTLGSYLCSCSVGFRLSVDGRSCEDINECSSSPC-SQECANVYGSYQC  463

Query  667  ECSPGSKL-DSTGLIC--IDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPC  723
             C  G +L D  G+ C  ID        +I   RC +NI G+   S  C + G       
Sbjct  464  YCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRC-INIPGSFQCS--CPSSGYRLAP--  518

Query  724  ERCELDTACSRGFARVNGVTCEDVNECDVFPGVCP-NGRCINSRGSFHC---ECPE  775
                            NG  C+D++EC      C  N  C N +G F C   ECPE
Sbjct  519  ----------------NGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPE  558


 Score = 111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 132/440 (30%), Positives = 183/440 (42%), Gaps = 83/440 (19%)

Query  1255  QCLNVPGAYRCECEMGFTPASDSKSCQDINEC-SFQNICVFG-TCNNLPGMFHCI----C  1308
             QC +      C C +G+   SD  SC+D+NEC +  + C  G +C N  G F C     C
Sbjct  189   QCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSC  248

Query  1309  DDGYELDRTGGNCTDVDECADPI-NCV-NGLCVNTPGRYECNCPPDFQLNPTGVGCVDNR  1366
               GYEL     +C D+DEC   I NC+ + +C NT G + C   P  Q      G + + 
Sbjct  249   GTGYELTE-DNSCKDIDECESGIHNCLPDFICQNTLGSFRCR--PKLQCKS---GFIQDA  302

Query  1367  VGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPG  1426
             +GNC                +I   +S S+ C       G+ C       + + N   P 
Sbjct  303   LGNC---------------IDINECLSISAPC-----PIGHTCINTEGSYTCQKNV--PN  340

Query  1427  -GEGFRPNPITIILEDIDECQELPGLC-QGGNCINTFGSFQCECPKGYYLSEETRICEDI  1484
              G G+  N       D+DEC      C +G  C+N+ GSF+CEC  GYY    +R+C D+
Sbjct  341   CGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDV  400

Query  1485  DECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENEL  1544
             +EC  +PG      C NTLG+Y C C   +     G +C D+ +       + + C  E 
Sbjct  401   NECQRYPGRLCGHKCENTLGSYLCSCSVGFRLSVDGRSCEDINEC------SSSPCSQEC  454

Query  1545  PFNVTKRMCCCT--YNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDE  1602
                     C C   Y +       CE                              DIDE
Sbjct  455   ANVYGSYQCYCRRGYQLSDVDGVTCE------------------------------DIDE  484

Query  1603  CKEIPG--ICANGVCINQIGSFRCECP-TGFSYNDLLLVCEDIDECSNGDNLCQRNADCI  1659
             C    G  IC+   CIN  GSF+C CP +G+        C+DIDEC  G + C  N  C 
Sbjct  485   CALPTGGHICSYR-CINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCF  543

Query  1660  NSPGSYRC---ECAAGFKLS  1676
             N  G +RC   EC   ++ S
Sbjct  544   NIQGGFRCLAFECPENYRRS  563


 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 95/169 (56%), Gaps = 9/169 (5%)

Query  272  NGPIITGLTILNQTIDICKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNG-DCTDVDEC  330
             G    G++ +   ++ C+ +P      +C  TL SY C C++G++   +G  C D++EC
Sbjct  386  TGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLGSYLCSCSVGFRLSVDGRSCEDINEC  445

Query  331  TSNPCSNGDCVNTPGSYYCKCHAGFQRTPTK-QACIDIDECI--QNGVLCKNGRCVNTDG  387
            +S+PCS  +C N  GSY C C  G+Q +      C DIDEC     G +C + RC+N  G
Sbjct  446  SSSPCSQ-ECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHIC-SYRCINIPG  503

Query  388  SFQCIC-NAGFELTTDGKNCVDHDECTT--TNMCLNGMCINEDGSFKCI  433
            SFQC C ++G+ L  +G+NC D DEC T   N  +N  C N  G F+C+
Sbjct  504  SFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCL  552


 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 128/416 (31%), Positives = 173/416 (42%), Gaps = 88/416 (21%)

Query  547  CSSGIGITVDG---RDINECALDPDICSNG-ICENLRGSYRC----NCNSGYEPDPSGRN  598
            C  G  +  DG    D+NEC      C  G  C N  GS+RC    +C +GYE      +
Sbjct  201  CFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELTEDN-S  259

Query  599  CVDIDECSVNRLLC-DNGLCRNTPGSYSC----TCPKGYVFSTETDTCEDINECES--SP  651
            C DIDEC      C  + +C+NT GS+ C     C  G++       C DINEC S  +P
Sbjct  260  CKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFI-QDALGNCIDINECLSISAP  318

Query  652  C-VNGACRNNLGSFNCE-----CSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVNINGA  705
            C +   C N  GS+ C+     C  G  L+  G  C+D                  ++  
Sbjct  319  CPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVD------------------VDEC  360

Query  706  TLKSECCATLGAAWGSPCE-RCELDTACSRGFARVNGVT--CEDVNECDVFPGVCPNGRC  762
               +E C        SP   RCE    C  G+   +G++  C DVNEC  +PG     +C
Sbjct  361  APPAEPCGKGHRCVNSPGSFRCE----CKTGYY-FDGISRMCVDVNECQRYPGRLCGHKC  415

Query  763  INSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRMDACCCAVGA  822
             N+ GS+ C C  G  L   GR C DI           +EC  S         C      
Sbjct  416  ENTLGSYLCSCSVGFRLSVDGRSCEDI-----------NECSSS--------PCSQECAN  456

Query  823  AWGSDCEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCM-NGKCR  881
             +GS            Y+  C RG   S+   +       +DI+EC +  G  + + +C 
Sbjct  457  VYGS------------YQCYCRRGYQLSDVDGVTC-----EDIDECALPTGGHICSYRCI  499

Query  882  NTIGSFKCKC-NSGFTLDMEERNCTDIDECWISPDLCG-SGTCVNTPGSFECECFD  935
            N  GSF+C C +SG+ L    RNC DIDEC      C  + TC N  G F C  F+
Sbjct  500  NIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFE  555


 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 77/149 (52%), Gaps = 11/149 (7%)

Query  39   GHPCEMCPAQPQ-PCRRGFIPNIRTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAG  97
            GH C   P   +  C+ G+  +  +  C DV+ECQ  PG   G  C NT+GSY C C  G
Sbjct  370  GHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLGSYLCSCSVG  429

Query  98   HKQNEATQKCDDIDECSIIPGICEGSECSNTVGSYFCICPRGY-VTSTDGSRC--IDQRA  154
             + +   + C+DI+ECS  P      EC+N  GSY C C RGY ++  DG  C  ID+ A
Sbjct  430  FRLSVDGRSCEDINECSSSPC---SQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECA  486

Query  155  STCFSNIVNGRCAQELPGRFTKRQCCCES  183
                 +I + RC   +PG F   QC C S
Sbjct  487  LPTGGHICSYRCIN-IPGSF---QCSCPS  511


 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 66/134 (49%), Gaps = 7/134 (5%)

Query  52   CRRGFIPNIRTGACQDVDECQAIPGVC-QGGNCINTVGSYECKCPAGHKQNEATQKCDDI  110
            C RG+  N     C DVDEC      C +G  C+N+ GS+ C+C  G+  +  ++ C D+
Sbjct  341  CGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDV  400

Query  111  DECSIIPGICEGSECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQEL  170
            +EC   PG   G +C NT+GSY C C  G+  S DG  C D       +   +  C+QE 
Sbjct  401  NECQRYPGRLCGHKCENTLGSYLCSCSVGFRLSVDGRSCED------INECSSSPCSQEC  454

Query  171  PGRFTKRQCCCESG  184
               +   QC C  G
Sbjct  455  ANVYGSYQCYCRRG  468


 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 55/107 (51%), Gaps = 8/107 (7%)

Query  52   CRRGFIPNIRTGACQDVDECQAIPGVCQ-GGNCINTVGSYECK-----CPAGHKQNEATQ  105
            C+ GFI +   G C D++EC +I   C  G  CINT GSY C+     C  G+  NE   
Sbjct  294  CKSGFIQDA-LGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGT  352

Query  106  KCDDIDECSIIPGIC-EGSECSNTVGSYFCICPRGYVTSTDGSRCID  151
            +C D+DEC+     C +G  C N+ GS+ C C  GY        C+D
Sbjct  353  RCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVD  399


 Score = 49.3 bits (116),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 54/99 (55%), Gaps = 12/99 (12%)

Query  64   ACQDVDECQA-IPGVCQGGNCINTVGSYECK----CPAGHKQNEATQKCDDIDECSIIPG  118
            +C+D+DEC++ I        C NT+GS+ C+    C +G  Q+ A   C DI+EC  I  
Sbjct  259  SCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQD-ALGNCIDINECLSISA  317

Query  119  ICE-GSECSNTVGSYFCI-----CPRGYVTSTDGSRCID  151
             C  G  C NT GSY C      C RGY  + +G+RC+D
Sbjct  318  PCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVD  356


> sp|Q9NQ36|SCUB2_HUMAN Signal peptide, CUB and EGF-like domain-containing 
protein 2 OS=Homo sapiens GN=SCUBE2 PE=2 SV=2
Length=999

 Score = 149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 134/420 (32%), Positives = 191/420 (45%), Gaps = 37/420 (9%)

Query  283  NQTIDICKHHPDLC-LNGRCIPTLSSYRCECNMGYKQDSNGDCTDVDECTSNPCSNG---  338
             + +D C    D C  +  C  T +SY+C C  GY Q     C D+DEC  N  + G   
Sbjct  43   QEDVDECAQGLDDCHADALCQNTPTSYKCSCKPGY-QGEGRQCEDIDEC-GNELNGGCVH  100

Query  339  DCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFE  398
            DC+N PG+Y C C  GF        C+D+DEC++N   C++  CVN  GS++C C  GF 
Sbjct  101  DCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQH-TCVNVMGSYECCCKEGFF  159

Query  399  LTTDGKNCVDHDE----CTTTNMCLNGMCINE-DGSFKCICKPGFVLAPNGRYCTDIDEC  453
            L+ +   C+   E    C   +   + +C     GS  C C+PGF LA N R C  I  C
Sbjct  160  LSDNQHTCIHRSEEGLSCMNKDHGCSHICKEAPRGSVACECRPGFELAKNQRDC--ILTC  217

Query  454  QTSGICMNGHCINTEGSFRCECPPGLAVGVDGRVCV---DTHMRSTCYGGIKKGACVRPF  510
                      C +T     C C P   +  DGR C+   DT +  T           +  
Sbjct  218  NHGNGGCQHSCDDTADGPECSCHPQYKMHTDGRSCLEREDTVLEVTESNTTSVVDGDKRV  277

Query  511  PGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGLCSSGIGITVDG---RDINECALDP  567
               +    C   N        C       S   H  C  G  + +DG   +DI+EC    
Sbjct  278  KRRLLMETCAVNNGG------CDRTCKDTSTGVHCSCPVGFTLQLDGKTCKDIDECQTRN  331

Query  568  DICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCT  627
              C +  C+N+ GS+ C C  G++     ++C D+DECS++R  CD+  C N PG+++C 
Sbjct  332  GGCDH-FCKNIVGSFDCGCKKGFKLLTDEKSCQDVDECSLDR-TCDHS-CINHPGTFACA  388

Query  628  CPKGYVFSTETDTCEDINECESSPCVNGACR----NNLGSFNCECSPGSKLDSTGLICID  683
            C +GY     T  C D NEC  +   NG C+    N +GS+ C+C PG KL      C++
Sbjct  389  CNRGYTLYGFTH-CGDTNECSIN---NGGCQQVCVNTVGSYECQCHPGYKLHWNKKDCVE  444


 Score = 146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 129/423 (30%), Positives = 193/423 (46%), Gaps = 30/423 (7%)

Query  949   DIDECERNPLLCRG-GTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKC  1007
             D+DEC +    C     C NT  S++C C  G++      +C D++EC    +      C
Sbjct  45    DVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQ--GEGRQCEDIDECGNELNGGCVHDC  102

Query  1008  VNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMP  1067
             +N+ G Y+C+C  G+    D  +C D+DEC+  NGGC   C N  GSYEC C +G+ L  
Sbjct  103   LNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSD  162

Query  1068  DVRTCADIDECE---SNPDICDGGQCTNIP-GEYRCLCYDGFMASMDMKTCIDVNECDLN  1123
             +  TC    E      N D      C   P G   C C  GF  + + + CI    C+  
Sbjct  163   NQHTCIHRSEEGLSCMNKDHGCSHICKEAPRGSVACECRPGFELAKNQRDCILT--CNHG  220

Query  1124  SNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFK  1183
             +  C    C++T     C C   Y +      C + ++  +     +  +    V G  +
Sbjct  221   NGGCQHS-CDDTADGPECSCHPQYKMHTDGRSCLEREDTVLEVTESNTTSV---VDGDKR  276

Query  1184  CSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFT--GDGFTCSDV  1241
                R          + ++ C+     C  +  C ++     C+C  GFT   DG TC D+
Sbjct  277   VKRR----------LLMETCAVNNGGC--DRTCKDTSTGVHCSCPVGFTLQLDGKTCKDI  324

Query  1242  DECAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLP  1301
             DEC      C++  C N+ G++ C C+ GF   +D KSCQD++ECS    C   +C N P
Sbjct  325   DECQTRNGGCDHF-CKNIVGSFDCGCKKGFKLLTDEKSCQDVDECSLDRTCDH-SCINHP  382

Query  1302  GMFHCICDDGYELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVG  1361
             G F C C+ GY L     +C D +EC+        +CVNT G YEC C P ++L+     
Sbjct  383   GTFACACNRGYTL-YGFTHCGDTNECSINNGGCQQVCVNTVGSYECQCHPGYKLHWNKKD  441

Query  1362  CVD  1364
             CV+
Sbjct  442   CVE  444


 Score = 128 bits (321),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 141/447 (32%), Positives = 200/447 (45%), Gaps = 57/447 (13%)

Query  559  DINECALDPDIC-SNGICENLRGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNG--  615
            D++ECA   D C ++ +C+N   SY+C+C  GY+ +  GR C DIDEC  N L   NG  
Sbjct  45   DVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGE--GRQCEDIDECG-NEL---NGGC  98

Query  616  --LCRNTPGSYSCTCPKGYVFSTETDTCEDINEC-ESSPCVNGACRNNLGSFNCECSPGS  672
               C N PG+Y CTC  G++ + +   C D++EC E++      C N +GS+ C C  G 
Sbjct  99   VHDCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGF  158

Query  673  KLDSTGLICID-SLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTA  731
             L      CI  S +G   +N +D  C      A   S  C                   
Sbjct  159  FLSDNQHTCIHRSEEGLSCMN-KDHGCSHICKEAPRGSVACE------------------  199

Query  732  CSRGFARV-NGVTCEDVNECDVFPGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIR  790
            C  GF    N   C  +  C+   G C +  C ++     C C     +   GR CL+  
Sbjct  200  CRPGFELAKNQRDC--ILTCNHGNGGCQHS-CDDTADGPECSCHPQYKMHTDGRSCLE--  254

Query  791  MEQCYLTWDEDECIRSVPG----KFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRG  846
             E   L   E      V G    K R+    CAV       C+   K  +      CP G
Sbjct  255  REDTVLEVTESNTTSVVDGDKRVKRRLLMETCAVN---NGGCDRTCKDTSTGVHCSCPVG  311

Query  847  PGFSNRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTD  906
                  G         KDI+EC+   G C +  C+N +GSF C C  GF L  +E++C D
Sbjct  312  FTLQLDGKTC------KDIDECQTRNGGC-DHFCKNIVGSFDCGCKKGFKLLTDEKSCQD  364

Query  907  IDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCV  966
            +DEC  S D     +C+N PG+F C C  GY        +C D +EC  N   C+   CV
Sbjct  365  VDEC--SLDRTCDHSCINHPGTFACACNRGYT--LYGFTHCGDTNECSINNGGCQ-QVCV  419

Query  967  NTEGSFQCDCPLGHELSPSREECIDVN  993
            NT GS++C C  G++L  ++++C++V 
Sbjct  420  NTVGSYECQCHPGYKLHWNKKDCVEVK  446


 Score = 119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 121/408 (30%), Positives = 170/408 (42%), Gaps = 85/408 (21%)

Query  1199  DLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECAENVHLCENGQCLN  1258
             D+DEC+ G   C  +A C N+P SY C+C  G+ G+G  C D+DEC   ++      CLN
Sbjct  45    DVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCEDIDECGNELNGGCVHDCLN  104

Query  1259  VPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYELDRTG  1318
             +PG YRC C  GF  A D  +C D++EC   N     TC N+ G + C C +G+ L    
Sbjct  105   IPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQ  164

Query  1319  GNCTDVDECADPINCVNG------LCVNTP-GRYECNCPPDFQLNPTGVGCV--------  1363
               C    E  + ++C+N       +C   P G   C C P F+L      C+        
Sbjct  165   HTCIHRSE--EGLSCMNKDHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNG  222

Query  1364  -------DNRVG---NCYLKYGPRGDGSLSC----NTEIGVGVSRSSCCCSLGKAWGNPC  1409
                    D   G   +C+ +Y    DG  SC    +T + V  S ++      K      
Sbjct  223   GCQHSCDDTADGPECSCHPQYKMHTDGR-SCLEREDTVLEVTESNTTSVVDGDKRVKRRL  281

Query  1410  --ETCPPVN----------STEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNC  1457
               ETC   N          ST  +  CP G   + +  T   +DIDECQ   G C    C
Sbjct  282   LMETCAVNNGGCDRTCKDTSTGVHCSCPVGFTLQLDGKTC--KDIDECQTRNGGCDHF-C  338

Query  1458  INTFGSFQCECPKGYYLSEETRICEDIDE----------CVAHPG----VCGPG------  1497
              N  GSF C C KG+ L  + + C+D+DE          C+ HPG     C  G      
Sbjct  339   KNIVGSFDCGCKKGFKLLTDEKSCQDVDECSLDRTCDHSCINHPGTFACACNRGYTLYGF  398

Query  1498  ------------------TCYNTLGNYTCICPPEYMQVNGGHNCMDMR  1527
                                C NT+G+Y C C P Y       +C++++
Sbjct  399   THCGDTNECSINNGGCQQVCVNTVGSYECQCHPGYKLHWNKKDCVEVK  446


 Score = 112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 118/400 (30%), Positives = 168/400 (42%), Gaps = 57/400 (14%)

Query  1683  DRNECLEIPNVC-SHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPCGN--GTC  1739
             D +EC +  + C +  LC +   SYKC C  G++    Q  C D+DEC     G     C
Sbjct  45    DVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQ--CEDIDECGNELNGGCVHDC  102

Query  1740  KNTVGSYNCLCYPGFELTHN-NDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYEL  1798
              N  G+Y C C+ GF L H+ ++C+D+DEC    G  C++  C N +GS++C C EG+ L
Sbjct  103   LNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGG-CQH-TCVNVMGSYECCCKEGFFL  160

Query  1799  TLDGKNCIDTNE----CVALPGSCSPGTCQNLEGSFRCICPPGYEVKSESCIDINECNED  1854
             + +   CI  +E    C+     CS    +   GS  C C PG+E+       I  CN  
Sbjct  161   SDNQHTCIHRSEEGLSCMNKDHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHG  220

Query  1855  PNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTK  1914
                C   SC +T  G +C C   + +  +GR C + R+       E+   SV       K
Sbjct  221   NGGCQH-SCDDTADGPECSCHPQYKMHTDGRSCLE-REDTVLEVTESNTTSVVDGDKRVK  278

Query  1915  AKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCS  1974
              +           G  C+   K+        CP G  T+     T +D++EC    G C 
Sbjct  279   RRLLMETCAVNNGG--CDRTCKDTSTGVHCSCPVGF-TLQLDGKTCKDIDECQTRNGGCD  335

Query  1975  N---------------------------------------GHCINTDGSFRCECPMGYNL  1995
             +                                         CIN  G+F C C  GY L
Sbjct  336   HFCKNIVGSFDCGCKKGFKLLTDEKSCQDVDECSLDRTCDHSCINHPGTFACACNRGYTL  395

Query  1996  DYTGVHCIDTDECSIGNPCGNGTCTNVIGSFECNCHEGFE  2035
              Y   HC DT+ECSI N      C N +GS+EC CH G++
Sbjct  396   -YGFTHCGDTNECSINNGGCQQVCVNTVGSYECQCHPGYK  434


 Score = 108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 118/412 (29%), Positives = 173/412 (42%), Gaps = 72/412 (17%)

Query  1440  EDIDEC-QELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGT  1498
             EDIDEC  EL G C   +C+N  G+++C C  G+ L+ +   C D+DEC+ + G C   T
Sbjct  85    EDIDECGNELNGGCVH-DCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGC-QHT  142

Query  1499  CYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTYN  1558
             C N +G+Y C C   +   +  H C+       +RS  G SC                 N
Sbjct  143   CVNVMGSYECCCKEGFFLSDNQHTCI-------HRSEEGLSC----------------MN  179

Query  1559  VGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICANGVCINQ  1618
                  +  C+  P    A     C   PGF  ++   +   I  C    G C +  C + 
Sbjct  180   KDHGCSHICKEAPRGSVA-----CECRPGF--ELAKNQRDCILTCNHGNGGCQHS-CDDT  231

Query  1619  IGSFRCECPTGFSYN----------DLLLVCEDIDECS--NGDNLCQR------------  1654
                  C C   +  +          D +L   + +  S  +GD   +R            
Sbjct  232   ADGPECSCHPQYKMHTDGRSCLEREDTVLEVTESNTTSVVDGDKRVKRRLLMETCAVNNG  291

Query  1655  --NADCINSPGSYRCECAAGFKLSPNG-ACVDRNECLEIPNVCSHGLCVDMQGSYKCICH  1711
               +  C ++     C C  GF L  +G  C D +EC      C H  C ++ GS+ C C 
Sbjct  292   GCDRTCKDTSTGVHCSCPVGFTLQLDGKTCKDIDECQTRNGGCDH-FCKNIVGSFDCGCK  350

Query  1712  NGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSF  1771
              GFK   D+  C DVDEC      + +C N  G++ C C  G+ L     C D +ECS  
Sbjct  351   KGFKLLTDEKSCQDVDECSLDRTCDHSCINHPGTFACACNRGYTLYGFTHCGDTNECSIN  410

Query  1772  FG---QVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSP  1820
              G   QV     C N +GS++C C+ GY+L  + K+C++      LP S SP
Sbjct  411   NGGCQQV-----CVNTVGSYECQCHPGYKLHWNKKDCVEVKG--LLPTSVSP  455


 Score = 100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 113/363 (31%), Positives = 158/363 (44%), Gaps = 71/363 (20%)

Query  1580  NICGN-----IPGFTFDIHSGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYND  1634
             NI GN       GF         +D+DEC E  G C +  C+N +GS+ C C  GF  +D
Sbjct  104   NIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQH-TCVNVMGSYECCCKEGFFLSD  162

Query  1635  LLLVC----EDIDECSNGDNLCQRNADCINSP-GSYRCECAAGFKLSPNGACVDRNECLE  1689
                 C    E+   C N D+ C     C  +P GS  CEC  GF+L+ N     + +C+ 
Sbjct  163   NQHTCIHRSEEGLSCMNKDHGCSH--ICKEAPRGSVACECRPGFELAKN-----QRDCIL  215

Query  1690  IPNVCSHG------LCVDMQGSYKCICHNGFKASQDQTMCMDVDEC--------------  1729
                 C+HG       C D     +C CH  +K   D   C++ ++               
Sbjct  216   ---TCNHGNGGCQHSCDDTADGPECSCHPQYKMHTDGRSCLEREDTVLEVTESNTTSVVD  272

Query  1730  -----------ERHPCGNG----TCKNTVGSYNCLCYPGFELTHN-NDCMDIDECSSFFG  1773
                        E     NG    TCK+T    +C C  GF L  +   C DIDEC +   
Sbjct  273   GDKRVKRRLLMETCAVNNGGCDRTCKDTSTGVHCSCPVGFTLQLDGKTCKDIDECQT---  329

Query  1774  QVCRNG----RCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGS  1829
                RNG     C N +GSF C C +G++L  D K+C D +EC +L  +C   +C N  G+
Sbjct  330   ---RNGGCDHFCKNIVGSFDCGCKKGFKLLTDEKSCQDVDEC-SLDRTCD-HSCINHPGT  384

Query  1830  FRCICPPGYEVKS-ESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCF  1888
             F C C  GY +     C D NEC+ +   C    C NT G ++C C  G+ L  N + C 
Sbjct  385   FACACNRGYTLYGFTHCGDTNECSINNGGCQ-QVCVNTVGSYECQCHPGYKLHWNKKDCV  443

Query  1889  DTR  1891
             + +
Sbjct  444   EVK  446


 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 117/447 (26%), Positives = 164/447 (37%), Gaps = 82/447 (18%)

Query  1074  DIDECESNPDICDG-GQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGEC  1132
             D+DEC    D C     C N P  Y+C C  G+    + + C D++EC    N     +C
Sbjct  45    DVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQG--EGRQCEDIDECGNELNGGCVHDC  102

Query  1133  ENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWV-  1191
              N  G++ C C  G+ +      C DVDEC      C    +CVNV GS++C C+EG+  
Sbjct  103   LNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGC--QHTCVNVMGSYECCCKEGFFL  160

Query  1192  -GNGIKCIDLDE----CSNGTHQCSVNAQCVNSP-GSYLCACVEGFTGDGFTCSDVDECA  1245
               N   CI   E    C N  H CS    C  +P GS  C C  GF         +  C 
Sbjct  161   SDNQHTCIHRSEEGLSCMNKDHGCS--HICKEAPRGSVACECRPGFELAKNQRDCILTCN  218

Query  1246  ENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQD-----------------------  1282
                  C++  C +      C C   +   +D +SC +                       
Sbjct  219   HGNGGCQHS-CDDTADGPECSCHPQYKMHTDGRSCLEREDTVLEVTESNTTSVVDGDKRV  277

Query  1283  -----INECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDECADPINCVNGL  1337
                  +  C+  N     TC +     HC C  G+ L   G  C D+DEC       +  
Sbjct  278   KRRLLMETCAVNNGGCDRTCKDTSTGVHCSCPVGFTLQLDGKTCKDIDECQTRNGGCDHF  337

Query  1338  CVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSC  1397
             C N  G ++C C   F+L      C D  V  C L          +C+          +C
Sbjct  338   CKNIVGSFDCGCKKGFKLLTDEKSCQD--VDECSL--------DRTCDHSCINHPGTFAC  387

Query  1398  CCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNC  1457
              C+ G               T Y     G              D +EC    G CQ   C
Sbjct  388   ACNRG--------------YTLYGFTHCG--------------DTNECSINNGGCQ-QVC  418

Query  1458  INTFGSFQCECPKGYYLSEETRICEDI  1484
             +NT GS++C+C  GY L    + C ++
Sbjct  419   VNTVGSYECQCHPGYKLHWNKKDCVEV  445


 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 79/152 (52%), Gaps = 5/152 (3%)

Query  301  CIPTLSSYRCECNMGYKQDSNGD-CTDVDEC-TSNPCSNGDCVNTPGSYYCKCHAGFQRT  358
            C  T +   C C +G+    +G  C D+DEC T N   +  C N  GS+ C C  GF+  
Sbjct  297  CKDTSTGVHCSCPVGFTLQLDGKTCKDIDECQTRNGGCDHFCKNIVGSFDCGCKKGFKLL  356

Query  359  PTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMC  418
              +++C D+DEC  +     +  C+N  G+F C CN G+ L     +C D +EC+  N  
Sbjct  357  TDEKSCQDVDECSLDRTC--DHSCINHPGTFACACNRGYTLY-GFTHCGDTNECSINNGG  413

Query  419  LNGMCINEDGSFKCICKPGFVLAPNGRYCTDI  450
               +C+N  GS++C C PG+ L  N + C ++
Sbjct  414  CQQVCVNTVGSYECQCHPGYKLHWNKKDCVEV  445


 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query  52   CRRGFIPNIRTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDID  111
            C  GF   +    C+D+DECQ   G C    C N VGS++C C  G K     + C D+D
Sbjct  308  CPVGFTLQLDGKTCKDIDECQTRNGGCDHF-CKNIVGSFDCGCKKGFKLLTDEKSCQDVD  366

Query  112  ECSIIPGICEGSECSNTVGSYFCICPRGYV  141
            ECS +   C+ S C N  G++ C C RGY 
Sbjct  367  ECS-LDRTCDHS-CINHPGTFACACNRGYT  394


 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 70/155 (45%), Gaps = 12/155 (8%)

Query  35   GRAWGHPCEMCPAQPQPCRRGFIPNIR---TGACQDVDEC-QAIPGVCQGGNCINTVGSY  90
            G AW     +    P     G +P  R    G  +DVDEC Q +        C NT  SY
Sbjct  10   GAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQNTPTSY  69

Query  91   ECKCPAGHKQNEATQKCDDIDEC-SIIPGICEGSECSNTVGSYFCICPRGYVTSTDGSRC  149
            +C C  G+ Q E  Q C+DIDEC + + G C   +C N  G+Y C C  G++ + DG  C
Sbjct  70   KCSCKPGY-QGEGRQ-CEDIDECGNELNGGCV-HDCLNIPGNYRCTCFDGFMLAHDGHNC  126

Query  150  IDQRASTCFSNIVNGRCAQELPGRFTKRQCCCESG  184
            +D     C  N  NG C           +CCC+ G
Sbjct  127  LD--VDECLEN--NGGCQHTCVNVMGSYECCCKEG  157


> sp|O95967|FBLN4_HUMAN EGF-containing fibulin-like extracellular 
matrix protein 2 OS=Homo sapiens GN=EFEMP2 PE=1 SV=3
Length=443

 Score = 144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 144/315 (46%), Gaps = 56/315 (18%)

Query  975   DCPLGHELSPSREECIDVNECSLSDSLCR-NGKCVNMVGTYQC-----------------  1016
             +C  G+E  P  + C DVNEC      C+   KC+N  G Y C                 
Sbjct  38    ECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPP  97

Query  1017  ----------SCNSGYQATPDRRSCTDIDECMIMNGGCH--THCTNSEGSYECSCSDGYA  1064
                        C  GY+   D+ SC D+DEC      C     C N  GSY+C+C DGY 
Sbjct  98    PPVPPAQHPNPCPPGYEPD-DQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYR  156

Query  1065  LM-PDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLN  1123
              + P+   C DIDEC      C   +C N+PG +RC C  GF    + ++C+DVNECD+ 
Sbjct  157   KIGPE---CVDIDECRYR--YCQH-RCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMG  210

Query  1124  SNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFK  1183
             +       C N+ G+F+C C  GY + +    C+D+DEC   ++ C     C+N PG F 
Sbjct  211   APC--EQRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYR--CINEPGRFS  266

Query  1184  CSCREGWVGNGIK-CIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVD  1242
             C C +G+     + C D+DEC +G HQCS    CVN  G             G+ C D +
Sbjct  267   CHCPQGYQLLATRLCQDIDECESGAHQCSEAQTCVNFHG-------------GYRCVDTN  313

Query  1243  ECAENVHLCENGQCL  1257
              C E        +CL
Sbjct  314   RCVEPYIQVSENRCL  328


 Score = 135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/246 (34%), Positives = 117/246 (48%), Gaps = 32/246 (13%)

Query  1143  CQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIK------  1196
             C  GY     +  C DV+EC      C     C+N  G + C  R   V N +       
Sbjct  39    CTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPP  98

Query  1197  ----------------------CIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGD  1234
                                   C+D+DEC+   H C  +  C N PGSY C C +G+   
Sbjct  99    PVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKI  158

Query  1235  GFTCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVF  1294
             G  C D+DEC      C++ +C+N+PG++RC+CE GF    +++SC D+NEC     C  
Sbjct  159   GPECVDIDEC--RYRYCQH-RCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCE-  214

Query  1295  GTCNNLPGMFHCICDDGYELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQ  1354
               C N  G F C C  GYEL R G +C+D+DEC+         C+N PGR+ C+CP  +Q
Sbjct  215   QRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCINEPGRFSCHCPQGYQ  274

Query  1355  LNPTGV  1360
             L  T +
Sbjct  275   LLATRL  280


 Score = 134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 98/268 (37%), Positives = 126/268 (47%), Gaps = 40/268 (15%)

Query  863   KDINECKVFPGMCM-NGKCRNTIGSFKC---------------------------KCNSG  894
             +D+NEC   P  C    KC N  G + C                            C  G
Sbjct  53    RDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPG  112

Query  895   FTLDMEERNCTDIDECWISPDLCG-SGTCVNTPGSFECECFDGYESGFMMMKNCMDIDEC  953
             +  D ++ +C D+DEC  +   C  S  C N PGS++C C DGY     +   C+DIDEC
Sbjct  113   YEPD-DQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRK---IGPECVDIDEC  168

Query  954   ERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGT  1013
                    R   CVN  GSF+C C  G +L P+   C+DVNEC +  + C   +C N  GT
Sbjct  169   RYRYCQHR---CVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMG-APCEQ-RCFNSYGT  223

Query  1014  YQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCA  1073
             + C C+ GY+   D  SC+DIDEC   +  C   C N  G + C C  GY L+   R C 
Sbjct  224   FLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCINEPGRFSCHCPQGYQLLA-TRLCQ  282

Query  1074  DIDECESNPDICDGGQ-CTNIPGEYRCL  1100
             DIDECES    C   Q C N  G YRC+
Sbjct  283   DIDECESGAHQCSEAQTCVNFHGGYRCV  310


 Score = 127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 102/297 (34%), Positives = 138/297 (46%), Gaps = 34/297 (11%)

Query  1059  CSDGYALMPDVRTCADIDECESNPDICDGG-QCTNIPGEYRCLCYDGFMASMDMKTCIDV  1117
             C+DGY   PD + C D++EC + P+ C G  +C N  G Y CL           ++   +
Sbjct  39    CTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCL----------PRSAAVI  88

Query  1118  NECDLNSNICMFGECENTKGSFICH---CQLGYSVKKGTTGCTDVDECEIGAHNCDMHAS  1174
             N+        + GE          H   C  GY        C DVDEC    H+C     
Sbjct  89    ND--------LHGEGPPPPVPPAQHPNPCPPGYE-PDDQDSCVDVDECAQALHDCRPSQD  139

Query  1175  CVNVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFT--  1232
             C N+PGS++C+C +G+   G +C+D+DEC     Q     +CVN PGS+ C C  GF   
Sbjct  140   CHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQ----HRCVNLPGSFRCQCEPGFQLG  195

Query  1233  GDGFTCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNIC  1292
              +  +C DV+EC      CE  +C N  G + C C  G+    D  SC DI+ECS+ +  
Sbjct  196   PNNRSCVDVNECDMGA-PCEQ-RCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYL  253

Query  1293  VFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDECADPIN--CVNGLCVNTPGRYEC  1347
                 C N PG F C C  GY+L  T   C D+DEC    +       CVN  G Y C
Sbjct  254   CQYRCINEPGRFSCHCPQGYQLLATRL-CQDIDECESGAHQCSEAQTCVNFHGGYRC  309


 Score = 125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 96/278 (35%), Positives = 138/278 (50%), Gaps = 40/278 (14%)

Query  1587  GFTFDIHSGKAVDIDECKEIPGICANGV-CINQIGSFRC---------------------  1624
             G+ +D  S    D++EC  IP  C   + CIN  G + C                     
Sbjct  42    GYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVP  101

Query  1625  ------ECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGF-KLSP  1677
                    CP G+  +D    C D+DEC+   + C+ + DC N PGSY+C C  G+ K+ P
Sbjct  102   PAQHPNPCPPGYEPDDQD-SCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGP  160

Query  1678  NGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPCGNG  1737
                CVD +EC      C H  CV++ GS++C C  GF+   +   C+DV+EC+       
Sbjct  161   E--CVDIDECRY--RYCQH-RCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQ  215

Query  1738  TCKNTVGSYNCLCYPGFELTHNN-DCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGY  1796
              C N+ G++ C C+ G+EL  +   C DIDEC S+   +C+  RC NE G F C C +GY
Sbjct  216   RCFNSYGTFLCRCHQGYELHRDGFSCSDIDEC-SYSSYLCQY-RCINEPGRFSCHCPQGY  273

Query  1797  ELTLDGKNCIDTNECVALPGSCSPG-TCQNLEGSFRCI  1833
             +L L  + C D +EC +    CS   TC N  G +RC+
Sbjct  274   QL-LATRLCQDIDECESGAHQCSEAQTCVNFHGGYRCV  310


 Score = 122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 92/282 (33%), Positives = 127/282 (45%), Gaps = 45/282 (16%)

Query  1018  CNSGYQATPDRRSCTDIDECMIMNGGC--HTHCTNSEGSYEC------------------  1057
             C  GY+  PD + C D++EC+ +   C     C N  G Y C                  
Sbjct  39    CTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPP  98

Query  1058  ---------SCSDGYALMPDVRTCADIDECESNPDICDGGQ-CTNIPGEYRCLCYDGFMA  1107
                       C  GY    D  +C D+DEC      C   Q C N+PG Y+C C DG+  
Sbjct  99    PVPPAQHPNPCPPGYE-PDDQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRK  157

Query  1108  SMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAH  1167
                   C+D++EC      C    C N  GSF C C+ G+ +      C DV+EC++GA 
Sbjct  158   I--GPECVDIDEC--RYRYCQH-RCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGA-  211

Query  1168  NCDMHASCVNVPGSFKCSCREGWV--GNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLC  1225
              C+    C N  G+F C C +G+    +G  C D+DECS  ++ C    +C+N PG + C
Sbjct  212   PCEQR--CFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQY--RCINEPGRFSC  267

Query  1226  ACVEGFTGDGF-TCSDVDECAENVHLCENGQ-CLNVPGAYRC  1265
              C +G+       C D+DEC    H C   Q C+N  G YRC
Sbjct  268   HCPQGYQLLATRLCQDIDECESGAHQCSEAQTCVNFHGGYRC  309


 Score = 116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 107/192 (56%), Gaps = 16/192 (8%)

Query  307  SYRCECNMGYKQDSNGDCTDVDECTSNPCSNGDCVNTPGSYYCKCHAGFQRTPTKQACID  366
            SY+C C  GY++    +C D+DEC    C +  CVN PGS+ C+C  GFQ  P  ++C+D
Sbjct  146  SYQCTCPDGYRK-IGPECVDIDECRYRYCQH-RCVNLPGSFRCQCEPGFQLGPNNRSCVD  203

Query  367  IDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINE  426
            ++EC   G  C+  RC N+ G+F C C+ G+EL  DG +C D DEC+ ++      CINE
Sbjct  204  VNEC-DMGAPCEQ-RCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCINE  261

Query  427  DGSFKCICKPGFVLAPNGRYCTDIDECQT-SGICMNGH-CINTEGSFRCECPPGLAVGVD  484
             G F C C  G+ L    R C DIDEC++ +  C     C+N  G +RC         VD
Sbjct  262  PGRFSCHCPQGYQLLAT-RLCQDIDECESGAHQCSEAQTCVNFHGGYRC---------VD  311

Query  485  GRVCVDTHMRST  496
               CV+ +++ +
Sbjct  312  TNRCVEPYIQVS  323


 Score = 111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 97/183 (53%), Gaps = 10/183 (5%)

Query  312  CNMGYKQDSNGDCTDVDECTS--NPCS-NGDCVNTPGSYYCKCHAGFQRTPTKQACIDID  368
            C  GY+ D    C DVDEC    + C  + DC N PGSY C C  G+++   +  C+DID
Sbjct  109  CPPGYEPDDQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPE--CVDID  166

Query  369  ECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDG  428
            EC      C++ RCVN  GSF+C C  GF+L  + ++CVD +EC     C    C N  G
Sbjct  167  ECRYR--YCQH-RCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPC-EQRCFNSYG  222

Query  429  SFKCICKPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCECPPGLAVGVDGRVC  488
            +F C C  G+ L  +G  C+DIDEC  S       CIN  G F C CP G  + +  R+C
Sbjct  223  TFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCINEPGRFSCHCPQGYQL-LATRLC  281

Query  489  VDT  491
             D 
Sbjct  282  QDI  284


 Score = 106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 113/389 (29%), Positives = 147/389 (38%), Gaps = 85/389 (22%)

Query  1190  WVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLC-----ACVEGFTGDGFTCSDVDEC  1244
             W  +   C D++EC      C    +C+N  G YLC     A +    G+G         
Sbjct  45    WDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQ  104

Query  1245  AENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECS--FQNICVFGTCNNLPG  1302
               N                   C  G+ P  D  SC D++EC+    +      C+NLPG
Sbjct  105   HPN------------------PCPPGYEP-DDQDSCVDVDECAQALHDCRPSQDCHNLPG  145

Query  1303  MFHCICDDGYELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGC  1362
              + C C DGY   + G  C D+DEC          CVN PG + C C P FQL P    C
Sbjct  146   SYQCTCPDGYR--KIGPECVDIDECR--YRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSC  201

Query  1363  VDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNT  1422
             VD  V  C +                                 G PCE         Y T
Sbjct  202   VD--VNECDM---------------------------------GAPCEQ---RCFNSYGT  223

Query  1423  -LCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRIC  1481
              LC   +G+  +       DIDEC     LCQ   CIN  G F C CP+GY L   TR+C
Sbjct  224   FLCRCHQGYELHRDGFSCSDIDECSYSSYLCQ-YRCINEPGRFSCHCPQGYQLL-ATRLC  281

Query  1482  EDIDECVAHPGVCGPG-TCYNTLGNYTCI----CPPEYMQVNGGH--------NCMDMRK  1528
             +DIDEC +    C    TC N  G Y C+    C   Y+QV+            C +   
Sbjct  282   QDIDECESGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYIQVSENRCLCPASNPLCREQPS  341

Query  1529  SFCYRSYNGTSCENELPFNVTKRMCCCTY  1557
             S  +R Y   + E  +P +V +      Y
Sbjct  342   SIVHR-YMTITSERSVPADVFQIQATSVY  369


 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 99/356 (28%), Positives = 144/356 (40%), Gaps = 81/356 (23%)

Query  621  PGSYSCTCPKGYVFSTETDTCEDINECESSPCVNGACRNNLGSFNCECSPGSKLDSTGLI  680
            P SY+  C  GY +  ++  C D+NEC + P    AC+  +   N            G +
Sbjct  33   PDSYT-ECTDGYEWDPDSQHCRDVNECLTIP---EACKGEMKCIN---------HYGGYL  79

Query  681  CIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVN  740
            C+              R    IN    +        A   +PC           G+   +
Sbjct  80   CL-------------PRSAAVINDLHGEGPPPPVPPAQHPNPC---------PPGYEPDD  117

Query  741  GVTCEDVNECDVFPGVC-PNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWD  799
              +C DV+EC      C P+  C N  GS+ C CP+G      G  C+DI  ++C   + 
Sbjct  118  QDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYR--KIGPECVDI--DECRYRYC  173

Query  800  EDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDILTGR  859
            +  C+ ++PG FR   C C  G   G +   C                            
Sbjct  174  QHRCV-NLPGSFR---CQCEPGFQLGPNNRSC----------------------------  201

Query  860  PFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGS  919
                D+NEC +  G     +C N+ G+F C+C+ G+ L  +  +C+DIDEC  S  LC  
Sbjct  202  ---VDVNECDM--GAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLC-Q  255

Query  920  GTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLC-RGGTCVNTEGSFQC  974
              C+N PG F C C  GY+   +  + C DIDECE     C    TCVN  G ++C
Sbjct  256  YRCINEPGRFSCHCPQGYQ--LLATRLCQDIDECESGAHQCSEAQTCVNFHGGYRC  309


 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 90/326 (28%), Positives = 129/326 (40%), Gaps = 72/326 (22%)

Query  1414  PVNSTEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGG-NCINTFGSFQC------  1466
             P +S E ++     +G+  +P +    D++EC  +P  C+G   CIN +G + C      
Sbjct  27    PQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAA  86

Query  1467  ---------------------ECPKGYYLSEETRICEDIDECVAHPGVCGPGT-CYNTLG  1504
                                   CP GY   ++   C D+DEC      C P   C+N  G
Sbjct  87    VINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDS-CVDVDECAQALHDCRPSQDCHNLPG  145

Query  1505  NYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWN  1564
             +Y C CP  Y ++  G  C+D+ +  C   Y    C N                      
Sbjct  146   SYQCTCPDGYRKI--GPECVDIDE--CRYRYCQHRCVN----------------------  179

Query  1565  KPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICANGVCINQIGSFRC  1624
                     PG+      C   PGF    ++   VD++EC    G      C N  G+F C
Sbjct  180   -------LPGSFR----CQCEPGFQLGPNNRSCVDVNECDM--GAPCEQRCFNSYGTFLC  226

Query  1625  ECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDR  1684
              C  G+  +     C DIDECS    LCQ    CIN PG + C C  G++L     C D 
Sbjct  227   RCHQGYELHRDGFSCSDIDECSYSSYLCQYR--CINEPGRFSCHCPQGYQLLATRLCQDI  284

Query  1685  NECLEIPNVCSHG-LCVDMQGSYKCI  1709
             +EC    + CS    CV+  G Y+C+
Sbjct  285   DECESGAHQCSEAQTCVNFHGGYRCV  310


 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 99/317 (31%), Positives = 136/317 (43%), Gaps = 46/317 (15%)

Query  716   GAAWGSPCERCELDTACSRGFAR-VNGVTCEDVNECDVFPGVCP-NGRCINSRGSFHCEC  773
             G+A     E  +  T C+ G+    +   C DVNEC   P  C    +CIN  G + C  
Sbjct  23    GSASPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLP  82

Query  774   PEGLT---LDGTGRVCLDIRMEQC------YLTWDEDECIRSVPGKFRMDACCCAVGAAW  824
                     L G G        +        Y   D+D C+        +D C  A+    
Sbjct  83    RSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVD-------VDECAQALHDCR  135

Query  825   GS-DCEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNGKCRNT  883
              S DC   P      Y+  CP G  +   G      P   DI+EC+     C + +C N 
Sbjct  136   PSQDCHNLPG----SYQCTCPDG--YRKIG------PECVDIDECRY--RYCQH-RCVNL  180

Query  884   IGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYE---SG  940
              GSF+C+C  GF L    R+C D++EC +         C N+ G+F C C  GYE    G
Sbjct  181   PGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPC--EQRCFNSYGTFLCRCHQGYELHRDG  238

Query  941   FMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDS  1000
             F    +C DIDEC  +  LC+   C+N  G F C CP G++L  +R  C D++EC     
Sbjct  239   F----SCSDIDECSYSSYLCQ-YRCINEPGRFSCHCPQGYQLLATR-LCQDIDECESGAH  292

Query  1001  LCRNGK-CVNMVGTYQC  1016
              C   + CVN  G Y+C
Sbjct  293   QCSEAQTCVNFHGGYRC  309


 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 94/333 (28%), Positives = 120/333 (36%), Gaps = 76/333 (23%)

Query  1710  CHNGFKASQDQTMCMDVDECERHP---CGNGTCKNTVGSYNCLCYPGFELTHNNDCMDID  1766
             C +G++   D   C DV+EC   P    G   C N  G Y  LC P      N+      
Sbjct  39    CTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGY--LCLPRSAAVIND------  90

Query  1767  ECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGT-CQN  1825
                   G+                 C  GYE   D  +C+D +EC      C P   C N
Sbjct  91    ----LHGE---GPPPPVPPAQHPNPCPPGYEPD-DQDSCVDVDECAQALHDCRPSQDCHN  142

Query  1826  LEGSFRCICPPGYEVKSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGR  1885
             L GS++C CP GY      C+DI+EC      C    C N PG F+C C  GF L  N R
Sbjct  143   LPGSYQCTCPDGYRKIGPECVDIDECRY--RYCQH-RCVNLPGSFRCQCEPGFQLGPNNR  199

Query  1886  RCFDTRQ--------SFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKE  1937
              C D  +          CF ++    C   + +   +    CS                 
Sbjct  200   SCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCS-----------------  242

Query  1938  EEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDY  1997
                                     D++EC  S  +C    CIN  G F C CP GY L  
Sbjct  243   ------------------------DIDECSYSSYLCQY-RCINEPGRFSCHCPQGYQLLA  277

Query  1998  TGVHCIDTDECSIG-NPCGNG-TCTNVIGSFEC  2028
             T + C D DEC  G + C    TC N  G + C
Sbjct  278   TRL-CQDIDECESGAHQCSEAQTCVNFHGGYRC  309


 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 94/328 (29%), Positives = 129/328 (39%), Gaps = 77/328 (23%)

Query  348  YCKCHAGFQRTPTKQACIDIDECIQNGVLCK-NGRCVNTDGSFQCI--------------  392
            Y +C  G++  P  Q C D++EC+     CK   +C+N  G + C+              
Sbjct  36   YTECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEG  95

Query  393  -------------CNAGFELTTDGKNCVDHDECTTT-NMCLNGM-CINEDGSFKCICKPG  437
                         C  G+E   D  +CVD DEC    + C     C N  GS++C C  G
Sbjct  96   PPPPVPPAQHPNPCPPGYE-PDDQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDG  154

Query  438  FVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCECPPGLAVGVDGRVCVDTHMRSTC  497
            +     G  C DIDEC+    C +  C+N  GSFRC+C PG  +G + R CVD       
Sbjct  155  YRKI--GPECVDIDECRYR-YCQH-RCVNLPGSFRCQCEPGFQLGPNNRSCVDV------  204

Query  498  YGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGLCSSGIGITVDG  557
                               +EC         G PC      +   F   C  G  +  DG
Sbjct  205  -------------------NEC-------DMGAPCEQRCFNSYGTFLCRCHQGYELHRDG  238

Query  558  ---RDINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDN  614
                DI+EC+    +C    C N  G + C+C  GY+   + R C DIDEC      C  
Sbjct  239  FSCSDIDECSYSSYLCQYR-CINEPGRFSCHCPQGYQL-LATRLCQDIDECESGAHQCSE  296

Query  615  G-LCRNTPGSYSCT----CPKGYVFSTE  637
               C N  G Y C     C + Y+  +E
Sbjct  297  AQTCVNFHGGYRCVDTNRCVEPYIQVSE  324


 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 111/275 (40%), Gaps = 70/275 (25%)

Query  1792  CNEGYELTLDGKNCIDTNECVALPGSCS-PGTCQNLEGSFRCI-----------------  1833
             C +GYE   D ++C D NEC+ +P +C     C N  G + C+                 
Sbjct  39    CTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPP  98

Query  1834  ----------CPPGYEVKSE-SCIDINECNEDPNICLFGS-CTNTPGGFQCICPTGFVLS  1881
                       CPPGYE   + SC+D++EC +  + C     C N PG +QC CP G+   
Sbjct  99    PVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGY--R  156

Query  1882  DNGRRCFDTRQSFCFTNFENGKC-SVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEV  1940
               G  C D  +  C   +   +C ++P +F     +C C                   E 
Sbjct  157   KIGPECVDIDE--CRYRYCQHRCVNLPGSF-----RCQC-------------------EP  190

Query  1941  AFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGV  2000
              FQ L P     +        DVNEC    G      C N+ G+F C C  GY L   G 
Sbjct  191   GFQ-LGPNNRSCV--------DVNEC--DMGAPCEQRCFNSYGTFLCRCHQGYELHRDGF  239

Query  2001  HCIDTDECSIGNPCGNGTCTNVIGSFECNCHEGFE  2035
              C D DECS  +      C N  G F C+C +G++
Sbjct  240   SCSDIDECSYSSYLCQYRCINEPGRFSCHCPQGYQ  274


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 5/137 (4%)

Query  300  RCIPTLSSYRCECNMGYKQ-DSNGDCTDVDECTSNPCSNGDCVNTPGSYYCKCHAGFQRT  358
            RC+    S+RC+C  G++   +N  C DV+EC         C N+ G++ C+CH G++  
Sbjct  176  RCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELH  235

Query  359  PTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTT-TNM  417
                +C DIDEC  +  LC+  RC+N  G F C C  G++L    + C D DEC +  + 
Sbjct  236  RDGFSCSDIDECSYSSYLCQY-RCINEPGRFSCHCPQGYQLLA-TRLCQDIDECESGAHQ  293

Query  418  CLNGM-CINEDGSFKCI  433
            C     C+N  G ++C+
Sbjct  294  CSEAQTCVNFHGGYRCV  310


 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 89/215 (41%), Gaps = 30/215 (14%)

Query  559  DINECALDPDICS-NGICENLRGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLC  617
            D++ECA     C  +  C NL GSY+C C  GY     G  CVDIDEC   R       C
Sbjct  123  DVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRK--IGPECVDIDEC---RYRYCQHRC  177

Query  618  RNTPGSYSCTCPKGYVFSTETDTCEDINECESSPCVNGACRNNLGSFNCECSPGSKLDST  677
             N PGS+ C C  G+       +C D+NEC+        C N+ G+F C C  G +L   
Sbjct  178  VNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELHRD  237

Query  678  GLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRGFA  737
            G  C D  + +    +   RC +N  G                           C +G+ 
Sbjct  238  GFSCSDIDECSYSSYLCQYRC-INEPG----------------------RFSCHCPQGYQ  274

Query  738  RVNGVTCEDVNECDVFPGVCPNGR-CINSRGSFHC  771
             +    C+D++EC+     C   + C+N  G + C
Sbjct  275  LLATRLCQDIDECESGAHQCSEAQTCVNFHGGYRC  309


 Score = 62.0 bits (149),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 102/408 (25%), Positives = 151/408 (37%), Gaps = 90/408 (22%)

Query  1211  SVNAQCVNSPGSYLCACVEGFTGD--GFTCSDVDECAENVHLCE-NGQCLNVPGAYRCEC  1267
             S + Q    P SY   C +G+  D     C DV+EC      C+   +C+N  G Y C  
Sbjct  24    SASPQDSEEPDSYT-ECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCL-  81

Query  1268  EMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDEC  1327
                       +S   IN+   +           P      C  GYE D    +C DVDEC
Sbjct  82    ---------PRSAAVINDLHGEGPPPPVPPAQHPNP----CPPGYEPD-DQDSCVDVDEC  127

Query  1328  ADPIN--CVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCN  1385
             A  ++    +  C N PG Y+C CP  ++    G  CVD  +  C  +Y         C 
Sbjct  128   AQALHDCRPSQDCHNLPGSYQCTCPDGYR--KIGPECVD--IDECRYRY---------CQ  174

Query  1386  TEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNPITIILEDIDEC  1445
                         C +L  ++   CE                  GF+  P      D++EC
Sbjct  175   HR----------CVNLPGSFRCQCEP-----------------GFQLGPNNRSCVDVNEC  207

Query  1446  QELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGN  1505
              ++   C+   C N++G+F C C +GY L  +   C DIDEC     +C    C N  G 
Sbjct  208   -DMGAPCEQ-RCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQ-YRCINEPGR  264

Query  1506  YTCICPPEYMQV------------NGGHNCMDMRKSFCYRSYNGTSCEN-----ELPFNV  1548
             ++C CP  Y  +            +G H C + +   C   + G  C +     E    V
Sbjct  265   FSCHCPQGYQLLATRLCQDIDECESGAHQCSEAQT--CVNFHGGYRCVDTNRCVEPYIQV  322

Query  1549  TKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICG--NIPGFTFDIHS  1594
             ++  C C      A N  C   P+     +  I    ++P   F I +
Sbjct  323   SENRCLC-----PASNPLCREQPSSIVHRYMTITSERSVPADVFQIQA  365


 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 56/111 (50%), Gaps = 6/111 (5%)

Query  65   CQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICEGSE  124
            C D+DEC+     CQ   C+N  GS+ C+C  G +     + C D++EC +    CE   
Sbjct  162  CVDIDECRY--RYCQH-RCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDM-GAPCE-QR  216

Query  125  CSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQELPGRFT  175
            C N+ G++ C C +GY    DG  C D    +  S +   RC  E PGRF+
Sbjct  217  CFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCINE-PGRFS  266


 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 82/225 (36%), Gaps = 53/225 (24%)

Query  1816  GSCSPGTCQNLEGSFRCICPPGYEVKSESCIDINECNEDPNICL-FGSCTNTPGGFQCIC  1874
             GS SP   +  +    C     ++  S+ C D+NEC   P  C     C N  GG+ C+ 
Sbjct  23    GSASPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLP  82

Query  1875  PTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELC  1934
              +  V++D                                       + GEG        
Sbjct  83    RSAAVIND---------------------------------------LHGEGPPP-----  98

Query  1935  PKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNGH-CINTDGSFRCECPMGY  1993
                      + CP G+   P   D+  DV+EC ++   C     C N  GS++C CP GY
Sbjct  99    -PVPPAQHPNPCPPGYE--PDDQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGY  155

Query  1994  NLDYTGVHCIDTDECSIGNPCGNGTCTNVIGSFECNCHEGFEPGP  2038
                  G  C+D DEC          C N+ GSF C C  GF+ GP
Sbjct  156   RK--IGPECVDIDECRYRY--CQHRCVNLPGSFRCQCEPGFQLGP  196


 Score = 49.7 bits (117),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 78/192 (41%), Gaps = 36/192 (19%)

Query  52   CRRGFIPNIRTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDID  111
            C +G+  +    +C D+DEC     +CQ   CIN  G + C CP G+ Q  AT+ C DID
Sbjct  228  CHQGYELHRDGFSCSDIDECSYSSYLCQY-RCINEPGRFSCHCPQGY-QLLATRLCQDID  285

Query  112  ECSIIPGIC-EGSECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCA---  167
            EC      C E   C N  G Y C+         D +RC++      +  +   RC    
Sbjct  286  ECESGAHQCSEAQTCVNFHGGYRCV---------DTNRCVEP-----YIQVSENRCLCPA  331

Query  168  -----QELPGRFTKRQCCCESGRCWAMGSVP-EMCPVRGSDEYRRLCVDGAPAGGGSRGG  221
                 +E P     R     S R     SVP ++  ++ +  Y      GA      R G
Sbjct  332  SNPLCREQPSSIVHRYMTITSER-----SVPADVFQIQATSVY-----PGAYNAFQIRAG  381

Query  222  GTGGNGFLPSGN  233
             + G+ ++   N
Sbjct  382  NSQGDFYIRQIN  393


 Score = 49.3 bits (116),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 66/162 (41%), Gaps = 38/162 (23%)

Query  52   CRRGFIPNIRTGACQDVDECQAIPGVCQGG-NCINTVGSYEC------------------  92
            C  G+  +  +  C+DV+EC  IP  C+G   CIN  G Y C                  
Sbjct  39   CTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPP  98

Query  93   ---------KCPAGHKQNEATQKCDDIDECSIIPGICEGSE-CSNTVGSYFCICPRGYVT  142
                      CP G++ ++    C D+DEC+     C  S+ C N  GSY C CP GY  
Sbjct  99   PVPPAQHPNPCPPGYEPDD-QDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGY--  155

Query  143  STDGSRCIDQRASTCFSNIVNGRCAQELPGRFTKRQCCCESG  184
               G  C+D     C       RC   LPG F   +C CE G
Sbjct  156  RKIGPECVD--IDECRYRYCQHRCVN-LPGSF---RCQCEPG  191


> sp|Q12805|FBLN3_HUMAN EGF-containing fibulin-like extracellular 
matrix protein 1 OS=Homo sapiens GN=EFEMP1 PE=1 SV=2
Length=493

 Score = 138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 102/339 (30%), Positives = 154/339 (45%), Gaps = 56/339 (17%)

Query  1058  SCSDGYALMPDVRTCADIDECESNPDICDGG-QCTNIPGEYRCL----------------  1100
              C+DGY   P  + C DIDEC+  PD C GG +C N  G Y CL                
Sbjct  28    QCTDGYEWDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEQPQQE  87

Query  1101  ---------CYDGFMASMDMKTCIDVNECDLNSNICMFG--ECENTKGSFIC--------  1141
                         G +A+  M T   +      ++       E +  + +F+         
Sbjct  88    TQPAEGTSGATTGVVAASSMATSGVLPGGGFVASAAAVAGPEMQTGRNNFVIRRNPADPQ  147

Query  1142  ----------HCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWV  1191
                        C  GY   +    C D+DEC  G HNC     C+N+ GSF C C  G+ 
Sbjct  148   RIPSNPSHRIQCAAGYEQSEHNV-CQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQ  206

Query  1192  GNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGF--TGDGFTCSDVDECAENVH  1249
               G +C+D+DEC+   +    + +CVN+PGS+ C C  GF    + +TC D++EC  +  
Sbjct  207   KRGEQCVDIDECTIPPY---CHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQ  263

Query  1250  LCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICD  1309
               +  QC N+ G++ C+C  G+  +SD  +C+DI+EC   +      C N PG F C+C 
Sbjct  264   CAQ--QCYNILGSFICQCNQGYELSSDRLNCEDIDECRTSSYLCQYQCVNEPGKFSCMCP  321

Query  1310  DGYELDRTGGNCTDVDECADPINCV-NGLCVNTPGRYEC  1347
              GY++ R+   C D++EC     C  + +C N  G + C
Sbjct  322   QGYQVVRS-RTCQDINECETTNECREDEMCWNYHGGFRC  359


 Score = 134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 113/352 (32%), Positives = 165/352 (47%), Gaps = 60/352 (17%)

Query  1587  GFTFDIHSGKAVDIDECKEIPGICANGV-CINQIGSFRCECPT-----------------  1628
             G+ +D    +  DIDEC  +P  C  G+ C+N  G + C   T                 
Sbjct  32    GYEWDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEQPQQETQPA  91

Query  1629  -------------------------GFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPG  1663
                                      GF  +   +   ++    N   + +  AD    P 
Sbjct  92    EGTSGATTGVVAASSMATSGVLPGGGFVASAAAVAGPEMQTGRNNFVIRRNPADPQRIPS  151

Query  1664  --SYRCECAAGFKLSPNGACVDRNECLEIPNVC-SHGLCVDMQGSYKCICHNGFKASQDQ  1720
               S+R +CAAG++ S +  C D +EC    + C +  +C++++GS+ C C  G++   +Q
Sbjct  152   NPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRGEQ  211

Query  1721  TMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNN-DCMDIDECSSFFGQVCRNG  1779
               C+D+DEC   P  +  C NT GS+ C C PGF+L  NN  C+DI+EC +     C   
Sbjct  212   --CVDIDECTIPPYCHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDA--SNQCAQ-  266

Query  1780  RCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYE  1839
             +C+N +GSF C CN+GYEL+ D  NC D +EC      C    C N  G F C+CP GY+
Sbjct  267   QCYNILGSFICQCNQGYELSSDRLNCEDIDECRTSSYLCQ-YQCVNEPGKFSCMCPQGYQ  325

Query  1840  -VKSESCIDINECNEDPNICLFGS-CTNTPGGFQCI----CPTGFVLSDNGR  1885
              V+S +C DINEC E  N C     C N  GGF+C     C   ++L+   R
Sbjct  326   VVRSRTCQDINEC-ETTNECREDEMCWNYHGGFRCYPRNPCQDPYILTPENR  376


 Score = 133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 106/358 (30%), Positives = 160/358 (45%), Gaps = 42/358 (12%)

Query  744   CEDVNECDVFPGVCPNG-RCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDE  802
             C+D++ECD+ P  C  G +C+N  G + C       L  T ++ ++          +E  
Sbjct  42    CKDIDECDIVPDACKGGMKCVNHYGGYLC-------LPKTAQIIVN----------NEQP  84

Query  803   CIRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFY  862
                + P +    A    V A+  +     P             G GF      + G    
Sbjct  85    QQETQPAEGTSGATTGVVAASSMATSGVLP-------------GGGFVASAAAVAGPEMQ  131

Query  863   KDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLC-GSGT  921
                N   +        +  +   S + +C +G+    E   C DIDEC      C     
Sbjct  132   TGRNNFVIRRNPADPQRIPSN-PSHRIQCAAGYE-QSEHNVCQDIDECTAGTHNCRADQV  189

Query  922   CVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHE  981
             C+N  GSF C+C  GY+      + C+DIDEC   P   +   CVNT GSF C C  G +
Sbjct  190   CINLRGSFACQCPPGYQK---RGEQCVDIDECTIPPYCHQ--RCVNTPGSFYCQCSPGFQ  244

Query  982   LSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMN  1041
             L+ +   C+D+NEC  S+   +  +C N++G++ C CN GY+ + DR +C DIDEC   +
Sbjct  245   LAANNYTCVDINECDASNQCAQ--QCYNILGSFICQCNQGYELSSDRLNCEDIDECRTSS  302

Query  1042  GGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRC  1099
               C   C N  G + C C  GY ++   RTC DI+ECE+  +  +   C N  G +RC
Sbjct  303   YLCQYQCVNEPGKFSCMCPQGYQVVRS-RTCQDINECETTNECREDEMCWNYHGGFRC  359


 Score = 128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 89/253 (35%), Positives = 130/253 (51%), Gaps = 14/253 (6%)

Query  248  PIPGSNGFSPGVGGAG--VGTGSSTGNGPIITGLTILNQTIDICKHHPDLCLNG---RCI  302
            P  G++G + GV  A     +G   G G + +   +    +   +++  +  N    + I
Sbjct  90   PAEGTSGATTGVVAASSMATSGVLPGGGFVASAAAVAGPEMQTGRNNFVIRRNPADPQRI  149

Query  303  PTLSSYRCECNMGYKQDSNGDCTDVDECTS---NPCSNGDCVNTPGSYYCKCHAGFQRTP  359
            P+  S+R +C  GY+Q  +  C D+DECT+   N  ++  C+N  GS+ C+C  G+Q+  
Sbjct  150  PSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKR-  208

Query  360  TKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCL  419
              + C+DIDEC        + RCVNT GSF C C+ GF+L  +   CVD +EC  +N C 
Sbjct  209  -GEQCVDIDECTIPPYC--HQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCA  265

Query  420  NGMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCECPPGL  479
               C N  GSF C C  G+ L+ +   C DIDEC+TS       C+N  G F C CP G 
Sbjct  266  Q-QCYNILGSFICQCNQGYELSSDRLNCEDIDECRTSSYLCQYQCVNEPGKFSCMCPQGY  324

Query  480  AVGVDGRVCVDTH  492
             V V  R C D +
Sbjct  325  QV-VRSRTCQDIN  336


 Score = 126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 97/174 (56%), Gaps = 5/174 (3%)

Query  301  CIPTLSSYRCECNMGYKQDSNGDCTDVDECTSNPCSNGDCVNTPGSYYCKCHAGFQRTPT  360
            CI    S+ C+C  GY Q     C D+DECT  P  +  CVNTPGS+YC+C  GFQ    
Sbjct  190  CINLRGSFACQCPPGY-QKRGEQCVDIDECTIPPYCHQRCVNTPGSFYCQCSPGFQLAAN  248

Query  361  KQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLN  420
               C+DI+EC  +    +  +C N  GSF C CN G+EL++D  NC D DEC T++    
Sbjct  249  NYTCVDINECDASNQCAQ--QCYNILGSFICQCNQGYELSSDRLNCEDIDECRTSSYLCQ  306

Query  421  GMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTSGICMNGH-CINTEGSFRC  473
              C+NE G F C+C  G+ +    R C DI+EC+T+  C     C N  G FRC
Sbjct  307  YQCVNEPGKFSCMCPQGYQVV-RSRTCQDINECETTNECREDEMCWNYHGGFRC  359


 Score = 125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 109/346 (32%), Positives = 154/346 (45%), Gaps = 24/346 (7%)

Query  890   KCNSGFTLDMEERNCTDIDECWISPDLCGSGT-CVNTPGSFECECFDGYESGFMMMKNCM  948
             +C  G+  D   + C DIDEC I PD C  G  CVN  G + C      ++  +++ N  
Sbjct  28    QCTDGYEWDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLCLP----KTAQIIVNNEQ  83

Query  949   DIDECERNPLLCRGGTCVNTEGSFQCDCPL---GHELSPSREECIDVNECSLSDSLCRNG  1005
                E +         T V    S      L   G   S +     ++     +  + RN 
Sbjct  84    PQQETQPAEGTSGATTGVVAASSMATSGVLPGGGFVASAAAVAGPEMQTGRNNFVIRRNP  143

Query  1006  KCVNMVGT---YQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTH--CTNSEGSYECSCS  1060
                  + +   ++  C +GY+ + +   C DIDEC      C     C N  GS+ C C 
Sbjct  144   ADPQRIPSNPSHRIQCAAGYEQS-EHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCP  202

Query  1061  DGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNEC  1120
              GY    +   C DIDEC + P  C   +C N PG + C C  GF  + +  TC+D+NEC
Sbjct  203   PGYQKRGE--QCVDIDEC-TIPPYCHQ-RCVNTPGSFYCQCSPGFQLAANNYTCVDINEC  258

Query  1121  DLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPG  1180
             D  SN C   +C N  GSFIC C  GY +      C D+DEC   ++ C     CVN PG
Sbjct  259   DA-SNQCA-QQCYNILGSFICQCNQGYELSSDRLNCEDIDECRTSSYLCQYQ--CVNEPG  314

Query  1181  SFKCSCREGW-VGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLC  1225
              F C C +G+ V     C D++EC   T++C  +  C N  G + C
Sbjct  315   KFSCMCPQGYQVVRSRTCQDINECET-TNECREDEMCWNYHGGFRC  359


 Score = 121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 116/217 (53%), Gaps = 12/217 (6%)

Query  928   SFECECFDGYESGFMMMKNCMDIDECERNPLLCRG-GTCVNTEGSFQCDCPLGHELSPSR  986
             S   +C  GYE     +  C DIDEC      CR    C+N  GSF C CP G++     
Sbjct  154   SHRIQCAAGYEQSEHNV--CQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQ--KRG  209

Query  987   EECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHT  1046
             E+C+D++EC++    C   +CVN  G++ C C+ G+Q   +  +C DI+EC   N  C  
Sbjct  210   EQCVDIDECTIP-PYCHQ-RCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQ-CAQ  266

Query  1047  HCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFM  1106
              C N  GS+ C C+ GY L  D   C DIDEC ++  +C   QC N PG++ C+C  G+ 
Sbjct  267   QCYNILGSFICQCNQGYELSSDRLNCEDIDECRTSSYLCQY-QCVNEPGKFSCMCPQGYQ  325

Query  1107  ASMDMKTCIDVNECDLNSNICMFGE-CENTKGSFICH  1142
               +  +TC D+NEC+  +N C   E C N  G F C+
Sbjct  326   V-VRSRTCQDINECE-TTNECREDEMCWNYHGGFRCY  360


 Score = 118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 118/380 (31%), Positives = 167/380 (44%), Gaps = 62/380 (16%)

Query  1467  ECPKGYYLSEETRICEDIDECVAHPGVCGPGT-CYNTLGNYTCICPPEYMQVNGGHNCMD  1525
             +C  GY      + C+DIDEC   P  C  G  C N  G Y C+     + VN       
Sbjct  28    QCTDGYEWDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLCLPKTAQIIVN-------  80

Query  1526  MRKSFCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPC--PTPGTAEFKNIC-  1582
                             NE P   T+               P E     T G     ++  
Sbjct  81    ----------------NEQPQQETQ---------------PAEGTSGATTGVVAASSMAT  109

Query  1583  -GNIPGFTFDIHSGKAVDIDECKE------IPGICANGVCINQIGSFRCECPTGFSYNDL  1635
              G +PG  F + S  AV   E +       I    A+   I    S R +C  G+  ++ 
Sbjct  110   SGVLPGGGF-VASAAAVAGPEMQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEH  168

Query  1636  LLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCS  1695
               VC+DIDEC+ G + C+ +  CIN  GS+ C+C  G++      CVD +EC  IP  C 
Sbjct  169   N-VCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQ-KRGEQCVDIDECT-IPPYC-  224

Query  1696  HGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFE  1755
             H  CV+  GS+ C C  GF+ + +   C+D++EC+        C N +GS+ C C  G+E
Sbjct  225   HQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYE  284

Query  1756  LTHNN-DCMDIDEC--SSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECV  1812
             L+ +  +C DIDEC  SS+  Q     +C NE G F C+C +GY++ +  + C D NEC 
Sbjct  285   LSSDRLNCEDIDECRTSSYLCQY----QCVNEPGKFSCMCPQGYQV-VRSRTCQDINECE  339

Query  1813  ALPGSCSPGTCQNLEGSFRC  1832
                       C N  G FRC
Sbjct  340   TTNECREDEMCWNYHGGFRC  359


 Score = 100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 116/430 (27%), Positives = 172/430 (40%), Gaps = 81/430 (19%)

Query  585   NCNSGYEPDPSGRNCVDIDECSVNRLLCDNGL-CRNTPGSYSCTCPKGYVFSTETDTCED  643
              C  GYE DP  + C DIDEC +    C  G+ C N  G Y C      +        ++
Sbjct  28    QCTDGYEWDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEQPQQE  87

Query  644   INECESSPCVNGACRNNLGSFNCECSPGSKLDSTGLI----CIDSLKGTCWLNIQDSRCE  699
                 E +   +GA    + +        S + ++G++     + S        +Q  R  
Sbjct  88    TQPAEGT---SGATTGVVAA--------SSMATSGVLPGGGFVASAAAVAGPEMQTGRNN  136

Query  700   VNINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVNGVTCEDVNECDVFPGVC-P  758
               I       +   +      +P  R +    C+ G+ +     C+D++EC      C  
Sbjct  137   FVIRRNPADPQRIPS------NPSHRIQ----CAAGYEQSEHNVCQDIDECTAGTHNCRA  186

Query  759   NGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLT-WDEDECIRSVPGKFRMDACC  817
             +  CIN RGSF C+CP G      G  C+DI  ++C +  +    C+ + PG F    C 
Sbjct  187   DQVCINLRGSFACQCPPGY--QKRGEQCVDI--DECTIPPYCHQRCVNT-PGSF---YCQ  238

Query  818   CAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMN  877
             C+ G    ++   C                                DINEC      C  
Sbjct  239   CSPGFQLAANNYTC-------------------------------VDINECDA-SNQCAQ  266

Query  878   GKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGY  937
              +C N +GSF C+CN G+ L  +  NC DIDEC  S  LC    CVN PG F C C  GY
Sbjct  267   -QCYNILGSFICQCNQGYELSSDRLNCEDIDECRTSSYLC-QYQCVNEPGKFSCMCPQGY  324

Query  938   ESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQC----DCPLGHELSPSREECIDVN  993
             +   +  + C DI+ECE          C N  G F+C     C   + L+P    C+   
Sbjct  325   Q--VVRSRTCQDINECETTNECREDEMCWNYHGGFRCYPRNPCQDPYILTP-ENRCV---  378

Query  994   ECSLSDSLCR  1003
              C +S+++CR
Sbjct  379   -CPVSNAMCR  387


 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 105/369 (28%), Positives = 144/369 (39%), Gaps = 69/369 (19%)

Query  434  CKPGFVLAPNGRYCTDIDECQ-TSGICMNG-HCINTEGSFRC----------------EC  475
            C  G+   P  + C DIDEC      C  G  C+N  G + C                E 
Sbjct  29   CTDGYEWDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEQPQQET  88

Query  476  PPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGE-----  530
             P  A G  G         S    G+  G       G    S    A P+   G      
Sbjct  89   QP--AEGTSGATTGVVAASSMATSGVLPG-------GGFVASAAAVAGPEMQTGRNNFVI  139

Query  531  ---PCHPCPAKNSAEFHGLCSSGIGITVDG--RDINECALDPDIC-SNGICENLRGSYRC  584
               P  P    ++      C++G   +     +DI+EC      C ++ +C NLRGS+ C
Sbjct  140  RRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFAC  199

Query  585  NCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDI  644
             C  GY+    G  CVDIDEC++      +  C NTPGS+ C C  G+  +    TC DI
Sbjct  200  QCPPGYQ--KRGEQCVDIDECTIPPYC--HQRCVNTPGSFYCQCSPGFQLAANNYTCVDI  255

Query  645  NECESSPCVNGACRNNLGSFNCECSPGSKLDSTGLIC--IDSLKGTCWLNIQDSRCEVNI  702
            NEC++S      C N LGSF C+C+ G +L S  L C  ID  + + +L      C+   
Sbjct  256  NECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRTSSYL------CQYQC  309

Query  703  NGATLKSECCATLGAAWGSPCERCELDTACSRGFARVNGVTCEDVNECDVFPGVCPNGRC  762
                 K  C                    C +G+  V   TC+D+NEC+       +  C
Sbjct  310  VNEPGKFSC-------------------MCPQGYQVVRSRTCQDINECETTNECREDEMC  350

Query  763  INSRGSFHC  771
             N  G F C
Sbjct  351  WNYHGGFRC  359


 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 119/413 (29%), Positives = 165/413 (40%), Gaps = 86/413 (21%)

Query  1308  CDDGYELDRTGGNCTDVDEC-ADPINCVNGL-CVNTPGRYECNCPPDFQLNPTGVGCVDN  1365
             C DGYE D     C D+DEC   P  C  G+ CVN  G Y C       L  T    V+N
Sbjct  29    CTDGYEWDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLC-------LPKTAQIIVNN  81

Query  1366  RVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCP  1425
                    +     +G+    T +   V+ SS   S     G    +   V   E  T   
Sbjct  82    EQPQ---QETQPAEGTSGATTGV---VAASSMATSGVLPGGGFVASAAAVAGPEMQT---  132

Query  1426  GGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDID  1485
             G   F      +I  +  + Q +P          +  S + +C  GY  SE   +C+DID
Sbjct  133   GRNNF------VIRRNPADPQRIP----------SNPSHRIQCAAGYEQSEHN-VCQDID  175

Query  1486  ECVAHPGVC-GPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRK----SFCYRSYNGTSC  1540
             EC A    C     C N  G++ C CPP Y +   G  C+D+ +     +C++      C
Sbjct  176   ECTAGTHNCRADQVCINLRGSFACQCPPGYQK--RGEQCVDIDECTIPPYCHQR-----C  228

Query  1541  ENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDI  1600
              N                             TPG+      C   PGF    ++   VDI
Sbjct  229   VN-----------------------------TPGSF----YCQCSPGFQLAANNYTCVDI  255

Query  1601  DECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCIN  1660
             +EC +    CA   C N +GSF C+C  G+  +   L CEDIDEC     LCQ    C+N
Sbjct  256   NEC-DASNQCAQQ-CYNILGSFICQCNQGYELSSDRLNCEDIDECRTSSYLCQ--YQCVN  311

Query  1661  SPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHG-LCVDMQGSYKCICHN  1712
              PG + C C  G+++  +  C D NEC E  N C    +C +  G ++C   N
Sbjct  312   EPGKFSCMCPQGYQVVRSRTCQDINEC-ETTNECREDEMCWNYHGGFRCYPRN  363


 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 77/244 (32%), Positives = 101/244 (41%), Gaps = 40/244 (16%)

Query  1787  SFKCLCNEGYELTLDGKNCIDTNECVALPGSC-SPGTCQNLEGSFRCICPPGYEVKSESC  1845
             S +  C  GYE + +   C D +EC A   +C +   C NL GSF C CPPGY+ + E C
Sbjct  154   SHRIQCAAGYEQS-EHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRGEQC  212

Query  1846  IDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCS  1905
             +DI+EC   P       C NTPG F C C  GF L+ N   C D                
Sbjct  213   VDIDECTIPPY--CHQRCVNTPGSFYCQCSPGFQLAANNYTCVD----------------  254

Query  1906  VPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNE  1965
                  N   A   C++      G     C +  E++   L               ED++E
Sbjct  255   ----INECDASNQCAQQCYNILGSFICQCNQGYELSSDRL-------------NCEDIDE  297

Query  1966  CLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCG-NGTCTNVIG  2024
             C  S  +C    C+N  G F C CP GY +  +   C D +EC   N C  +  C N  G
Sbjct  298   CRTSSYLCQY-QCVNEPGKFSCMCPQGYQVVRSRT-CQDINECETTNECREDEMCWNYHG  355

Query  2025  SFEC  2028
              F C
Sbjct  356   GFRC  359


 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 5/89 (6%)

Query  64   ACQDVDECQAIPGVCQGGN-CINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICEG  122
             CQD+DEC A    C+    CIN  GS+ C+CP G+++    ++C DIDEC+ IP  C  
Sbjct  170  VCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKR--GEQCVDIDECT-IPPYCH-  225

Query  123  SECSNTVGSYFCICPRGYVTSTDGSRCID  151
              C NT GS++C C  G+  + +   C+D
Sbjct  226  QRCVNTPGSFYCQCSPGFQLAANNYTCVD  254


 Score = 55.8 bits (133),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 86/343 (25%), Positives = 123/343 (36%), Gaps = 63/343 (18%)

Query  1710  CHNGFKASQDQTMCMDVDECERHP---CGNGTCKNTVGSYNCLCYPGFELTHNNDCMDID  1766
             C +G++    +  C D+DEC+  P    G   C N  G Y  LC P       N+     
Sbjct  29    CTDGYEWDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGY--LCLPKTAQIIVNNEQPQQ  86

Query  1767  ECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCS-------  1819
             E     G           + +   +   G    L G   + +   VA P   +       
Sbjct  87    ETQPAEG----TSGATTGVVAASSMATSG---VLPGGGFVASAAAVAGPEMQTGRNNFVI  139

Query  1820  ---PGTCQNLEG--SFRCICPPGYEVKSES-CIDINECNEDPNICLFGS-CTNTPGGFQC  1872
                P   Q +    S R  C  GYE    + C DI+EC    + C     C N  G F C
Sbjct  140   RRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFAC  199

Query  1873  ICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCE  1932
              CP G+     G +C D             +C++P   +       C   PG  +   C+
Sbjct  200   QCPPGY--QKRGEQCVDI-----------DECTIPPYCHQR-----CVNTPGSFY---CQ  238

Query  1933  LCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPMG  1992
               P  +  A    C               D+NEC ++   C+   C N  GSF C+C  G
Sbjct  239   CSPGFQLAANNYTC--------------VDINEC-DASNQCAQ-QCYNILGSFICQCNQG  282

Query  1993  YNLDYTGVHCIDTDECSIGNPCGNGTCTNVIGSFECNCHEGFE  2035
             Y L    ++C D DEC   +      C N  G F C C +G++
Sbjct  283   YELSSDRLNCEDIDECRTSSYLCQYQCVNEPGKFSCMCPQGYQ  325


 Score = 53.1 bits (126),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 59/124 (48%), Gaps = 8/124 (6%)

Query  61   RTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGIC  120
            R   C D+DEC  IP  C    C+NT GS+ C+C  G +       C DI+EC      C
Sbjct  208  RGEQCVDIDEC-TIPPYCHQ-RCVNTPGSFYCQCSPGFQLAANNYTCVDINECD-ASNQC  264

Query  121  EGSECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQELPGRFTKRQCC  180
               +C N +GS+ C C +GY  S+D   C D       S +   +C  E PG+F+   C 
Sbjct  265  -AQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRTSSYLCQYQCVNE-PGKFS---CM  319

Query  181  CESG  184
            C  G
Sbjct  320  CPQG  323


 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 46/89 (52%), Gaps = 3/89 (3%)

Query  52   CRRGFIPNIRTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDID  111
            C  GF        C D++EC A     Q   C N +GS+ C+C  G++ +     C+DID
Sbjct  239  CSPGFQLAANNYTCVDINECDASNQCAQ--QCYNILGSFICQCNQGYELSSDRLNCEDID  296

Query  112  ECSIIPGICEGSECSNTVGSYFCICPRGY  140
            EC     +C+  +C N  G + C+CP+GY
Sbjct  297  ECRTSSYLCQ-YQCVNEPGKFSCMCPQGY  324


> sp|Q9UBX5|FBLN5_HUMAN Fibulin-5 OS=Homo sapiens GN=FBLN5 PE=1 
SV=1
Length=448

 Score = 134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 92/283 (33%), Positives = 127/283 (45%), Gaps = 48/283 (17%)

Query  1126  ICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCS  1185
             + +   C  + G+    C  G+ + + +  C D+DEC      C     CVN  G + C 
Sbjct  10    VTILALCLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLCI  69

Query  1186  CREGWVGNGI--------------------------------------------KCIDLD  1201
              R   V  G                                             +C+D+D
Sbjct  70    PRTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESNQCVDVD  129

Query  1202  ECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECAENVHLCENGQCLNVPG  1261
             EC+  +HQC+    C+N+ G Y C+C +G+      C D+DEC      C+   C NVPG
Sbjct  130   ECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDEC--RYGYCQQ-LCANVPG  186

Query  1262  AYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNC  1321
             +Y C C  GFT   D +SCQD+NEC+ +N CV  TC N  G F C CD GYEL+  G +C
Sbjct  187   SYSCTCNPGFTLNEDGRSCQDVNECATENPCV-QTCVNTYGSFICRCDPGYELEEDGVHC  245

Query  1322  TDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVD  1364
             +D+DEC+         CVN PG Y C+CPP + L      C D
Sbjct  246   SDMDECSFSEFLCQHECVNQPGTYFCSCPPGYILLDDNRSCQD  288


 Score = 133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 102/325 (31%), Positives = 147/325 (45%), Gaps = 46/325 (14%)

Query  880   CRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLC-GSGTCVNTPGSFEC-------  931
             C  + G+ + +C +GF LD +   C DIDEC   P+ C G   CVN  G + C       
Sbjct  16    CLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLCIPRTNPV  75

Query  932   ----------ECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHE  981
                         + G         +  +     R PL+CR                 G++
Sbjct  76    YRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISR-PLICR----------------FGYQ  118

Query  982   LSPSREECIDVNECSLSDSLCRNGK-CVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIM  1040
             +  S  +C+DV+EC+     C   + C+N  G Y CSC  GY     +  C DIDEC   
Sbjct  119   MDES-NQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQ--CLDIDECRY-  174

Query  1041  NGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECES-NPDICDGGQCTNIPGEYRC  1099
              G C   C N  GSY C+C+ G+ L  D R+C D++EC + NP +     C N  G + C
Sbjct  175   -GYCQQLCANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCV---QTCVNTYGSFIC  230

Query  1100  LCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDV  1159
              C  G+    D   C D++EC  +  +C   EC N  G++ C C  GY +      C D+
Sbjct  231   RCDPGYELEEDGVHCSDMDECSFSEFLCQH-ECVNQPGTYFCSCPPGYILLDDNRSCQDI  289

Query  1160  DECEIGAHNCDMHASCVNVPGSFKC  1184
             +ECE   H C++  +C N+ G FKC
Sbjct  290   NECEHRNHTCNLQQTCYNLQGGFKC  314


 Score = 133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 111/312 (36%), Positives = 153/312 (49%), Gaps = 19/312 (6%)

Query  1571  PTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGIC-ANGVCINQIGSFRCECPTG  1629
             P+PG A+ +  C N  GF  D  SG+ +DIDEC+ IP  C  + +C+NQ G + C   T 
Sbjct  18    PSPGNAQAQ--CTN--GFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLCIPRTN  73

Query  1630  FSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYR-CECAAGFKLSPNGACVDRNECL  1688
               Y             S             N P   R   C  G+++  +  CVD +EC 
Sbjct  74    PVYRGPYSNPYSTPY-SGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESNQCVDVDECA  132

Query  1689  EIPNVCS-HGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYN  1747
                + C+   +C++ +G Y C C +G+   + Q  C+D+DEC    C    C N  GSY+
Sbjct  133   TDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQ--CLDIDECRYGYCQQ-LCANVPGSYS  189

Query  1748  CLCYPGFELTHN-NDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCI  1806
             C C PGF L  +   C D++EC++    V     C N  GSF C C+ GYEL  DG +C 
Sbjct  190   CTCNPGFTLNEDGRSCQDVNECATENPCV---QTCVNTYGSFICRCDPGYELEEDGVHCS  246

Query  1807  DTNECVALPGSCSPGTCQNLEGSFRCICPPGYEV--KSESCIDINECNEDPNIC-LFGSC  1863
             D +EC      C    C N  G++ C CPPGY +   + SC DINEC    + C L  +C
Sbjct  247   DMDECSFSEFLCQ-HECVNQPGTYFCSCPPGYILLDDNRSCQDINECEHRNHTCNLQQTC  305

Query  1864  TNTPGGFQCICP  1875
              N  GGF+CI P
Sbjct  306   YNLQGGFKCIDP  317


 Score = 125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 111/341 (33%), Positives = 152/341 (45%), Gaps = 43/341 (13%)

Query  762   CINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRMDACCCAVG  821
             C+ S G+   +C  G  LD     CLDI           DEC R++P   R D  C  V 
Sbjct  16    CLPSPGNAQAQCTNGFDLDRQSGQCLDI-----------DEC-RTIPEACRGDMMC--VN  61

Query  822   AAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNGKCR  881
                G  C     P          RGP +SN        P+    +         ++    
Sbjct  62    QNGGYLCIPRTNP--------VYRGP-YSN--------PYSTPYSGPYPAAAPPLSAPNY  104

Query  882   NTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCG-SGTCVNTPGSFECECFDGYESG  940
              TI S    C  G+ +D E   C D+DEC      C  +  C+NT G + C C DGY   
Sbjct  105   PTI-SRPLICRFGYQMD-ESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGY---  159

Query  941   FMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDS  1000
             +++   C+DIDEC      C+   C N  GS+ C C  G  L+     C DVNEC+  + 
Sbjct  160   WLLEGQCLDIDECRYG--YCQQ-LCANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENP  216

Query  1001  LCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCS  1060
               +   CVN  G++ C C+ GY+   D   C+D+DEC      C   C N  G+Y CSC 
Sbjct  217   CVQT--CVNTYGSFICRCDPGYELEEDGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCP  274

Query  1061  DGYALMPDVRTCADIDECESNPDICDGGQ-CTNIPGEYRCL  1100
              GY L+ D R+C DI+ECE     C+  Q C N+ G ++C+
Sbjct  275   PGYILLDDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCI  315


 Score = 124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 100/319 (31%), Positives = 141/319 (44%), Gaps = 15/319 (5%)

Query  1039  IMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQ-CTNIPGEY  1097
             I+       C  S G+ +  C++G+ L      C DIDEC + P+ C G   C N  G Y
Sbjct  7     ILTVTILALCLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGY  66

Query  1098  RCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKG-SFICHCQLGYSVKKGTTGC  1156
              C+     +                           N    S    C+ GY + + +  C
Sbjct  67    LCIPRTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDE-SNQC  125

Query  1157  TDVDECEIGAHNCDMHASCVNVPGSFKCSCREG-WVGNGIKCIDLDECSNGTHQCSVNAQ  1215
              DVDEC   +H C+    C+N  G + CSC +G W+  G +C+D+DEC  G  Q      
Sbjct  126   VDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEG-QCLDIDECRYGYCQ----QL  180

Query  1216  CVNSPGSYLCACVEGFT--GDGFTCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTP  1273
             C N PGSY C C  GFT   DG +C DV+ECA      +   C+N  G++ C C+ G+  
Sbjct  181   CANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCVQT--CVNTYGSFICRCDPGYEL  238

Query  1274  ASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDECADPINC  1333
               D   C D++ECSF        C N PG + C C  GY L     +C D++EC    + 
Sbjct  239   EEDGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCPPGYILLDDNRSCQDINECEHRNHT  298

Query  1334  --VNGLCVNTPGRYECNCP  1350
               +   C N  G ++C  P
Sbjct  299   CNLQQTCYNLQGGFKCIDP  317


 Score = 124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/212 (37%), Positives = 106/212 (50%), Gaps = 19/212 (9%)

Query  312  CNMGYKQDSNGDCTDVDECTSNPCS---NGDCVNTPGSYYCKCHAGFQRTPTKQACIDID  368
            C  GY+ D +  C DVDEC ++         C+NT G Y C C  G+     +  C+DID
Sbjct  113  CRFGYQMDESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLL--EGQCLDID  170

Query  369  ECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDG  428
            EC      C+   C N  GS+ C CN GF L  DG++C D +EC T N C+   C+N  G
Sbjct  171  ECRYG--YCQQ-LCANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCVQ-TCVNTYG  226

Query  429  SFKCICKPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCECPPGLAVGVDGRVC  488
            SF C C PG+ L  +G +C+D+DEC  S       C+N  G++ C CPPG  +  D R C
Sbjct  227  SFICRCDPGYELEEDGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCPPGYILLDDNRSC  286

Query  489  VDT----------HMRSTCYGGIKKGACVRPF  510
             D           +++ TCY       C+ P 
Sbjct  287  QDINECEHRNHTCNLQQTCYNLQGGFKCIDPI  318


 Score = 110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 92/178 (52%), Gaps = 6/178 (3%)

Query  301  CIPTLSSYRCECNMGYKQDSNGDCTDVDECTSNPCSNGDCVNTPGSYYCKCHAGFQRTPT  360
            CI T   Y C C  GY     G C D+DEC    C    C N PGSY C C+ GF     
Sbjct  144  CINTEGGYTCSCTDGYWL-LEGQCLDIDECRYGYCQQL-CANVPGSYSCTCNPGFTLNED  201

Query  361  KQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLN  420
             ++C D++EC       +   CVNT GSF C C+ G+EL  DG +C D DEC+ +     
Sbjct  202  GRSCQDVNECATENPCVQT--CVNTYGSFICRCDPGYELEEDGVHCSDMDECSFSEFLCQ  259

Query  421  GMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTSGIC--MNGHCINTEGSFRCECP  476
              C+N+ G++ C C PG++L  + R C DI+EC+       +   C N +G F+C  P
Sbjct  260  HECVNQPGTYFCSCPPGYILLDDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCIDP  317


 Score = 105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 96/331 (29%), Positives = 136/331 (41%), Gaps = 74/331 (22%)

Query  1007  CVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCH--THCTNSEGSYEC-------  1057
             C+   G  Q  C +G+        C DIDEC  +   C     C N  G Y C       
Sbjct  16    CLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLCIPRTNPV  75

Query  1058  ------------------------------------SCSDGYALMPDVRTCADIDECESN  1081
                                                  C  GY  M +   C D+DEC ++
Sbjct  76    YRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQ-MDESNQCVDVDECATD  134

Query  1082  PDICDGGQ-CTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECE----NTK  1136
                C+  Q C N  G Y C C DG+   +    C+D++E       C +G C+    N  
Sbjct  135   SHQCNPTQICINTEGGYTCSCTDGYW--LLEGQCLDIDE-------CRYGYCQQLCANVP  185

Query  1137  GSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGW--VGNG  1194
             GS+ C C  G+++ +    C DV+EC   A       +CVN  GSF C C  G+    +G
Sbjct  186   GSYSCTCNPGFTLNEDGRSCQDVNEC---ATENPCVQTCVNTYGSFICRCDPGYELEEDG  242

Query  1195  IKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFT--GDGFTCSDVDECAENVHLCE  1252
             + C D+DECS     C    +CVN PG+Y C+C  G+    D  +C D++EC    H C 
Sbjct  243   VHCSDMDECSFSEFLC--QHECVNQPGTYFCSCPPGYILLDDNRSCQDINECEHRNHTCN  300

Query  1253  NGQ-CLNVPGAYRC----ECEMGFTPASDSK  1278
               Q C N+ G ++C     CE  +   SD++
Sbjct  301   LQQTCYNLQGGFKCIDPIRCEEPYLRISDNR  331


 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 107/392 (27%), Positives = 154/392 (39%), Gaps = 80/392 (20%)

Query  421  GMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTSGICMNG--HCINTEGSFRCECPPG  478
             +C+   G+ +  C  GF L      C DIDEC+T      G   C+N  G + C     
Sbjct  14   ALCLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLC-----  68

Query  479  LAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAK  538
                            +  Y G        P+ G    +    + P+Y    P    P  
Sbjct  69   ------------IPRTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNY----PTISRPL-  111

Query  539  NSAEFHGLCSSGIGITVDGR--DINECALDPDICS-NGICENLRGSYRCNCNSGYEPDPS  595
                   +C  G  +    +  D++ECA D   C+   IC N  G Y C+C  GY     
Sbjct  112  -------ICRFGYQMDESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEG  164

Query  596  GRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINECES-SPCVN  654
               C+DIDEC          LC N PGSYSCTC  G+  + +  +C+D+NEC + +PCV 
Sbjct  165  --QCLDIDECRYGYC---QQLCANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCVQ  219

Query  655  GACRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCAT  714
              C N  GSF C C PG +L+  G+ C D               E + +    + EC   
Sbjct  220  -TCVNTYGSFICRCDPGYELEEDGVHCSDMD-------------ECSFSEFLCQHECVNQ  265

Query  715  LGAAWGSPCERCELDTACSRGFARV-NGVTCEDVNECDVFPGVC-PNGRCINSRGSFHCE  772
             G  + S          C  G+  + +  +C+D+NEC+     C     C N +G F C 
Sbjct  266  PGTYFCS----------CPPGYILLDDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCI  315

Query  773  CPEGLTLDGTGRVCLDIRMEQCYLTWDEDECI  804
             P              IR E+ YL   ++ C+
Sbjct  316  DP--------------IRCEEPYLRISDNRCM  333


 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 89/171 (52%), Gaps = 12/171 (7%)

Query  864   DINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCV  923
             DI+EC+   G C    C N  GS+ C CN GFTL+ + R+C D++EC  + + C   TCV
Sbjct  168   DIDECRY--GYCQQ-LCANVPGSYSCTCNPGFTLNEDGRSCQDVNEC-ATENPCVQ-TCV  222

Query  924   NTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELS  983
             NT GSF C C  GYE     + +C D+DEC  +  LC+   CVN  G++ C CP G+ L 
Sbjct  223   NTYGSFICRCDPGYELEEDGV-HCSDMDECSFSEFLCQ-HECVNQPGTYFCSCPPGYILL  280

Query  984   PSREECIDVNECSLSDSLCR-NGKCVNMVGTYQC----SCNSGYQATPDRR  1029
                  C D+NEC   +  C     C N+ G ++C     C   Y    D R
Sbjct  281   DDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCIDPIRCEEPYLRISDNR  331


 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 102/370 (28%), Positives = 154/370 (42%), Gaps = 71/370 (19%)

Query  615  GLCRNTPGSYSCTCPKGYVFSTETDTCEDINECESSPCVNGACRNNLGSFNCECSPGSKL  674
             LC  +PG+    C  G+    ++  C DI+EC + P    ACR ++   N         
Sbjct  14   ALCLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIP---EACRGDMMCVN---------  61

Query  675  DSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACSR  734
             + G +CI       +     +      +G    +   A   +A   P     L   C  
Sbjct  62   QNGGYLCIPRTNPV-YRGPYSNPYSTPYSGPYPAA---APPLSAPNYPTISRPL--ICRF  115

Query  735  GFARVNGVTCEDVNECDVFPGVC-PNGRCINSRGSFHCECPEGL-TLDGTGRVCLDIRME  792
            G+       C DV+EC      C P   CIN+ G + C C +G   L+G    CLDI  +
Sbjct  116  GYQMDESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQ---CLDI--D  170

Query  793  QCYLTWDEDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNR  852
            +C   + +  C  +VPG +   +C C  G     D   C                     
Sbjct  171  ECRYGYCQQLCA-NVPGSY---SCTCNPGFTLNEDGRSC---------------------  205

Query  853  GDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWI  912
                      +D+NEC      C+   C NT GSF C+C+ G+ L+ +  +C+D+DEC  
Sbjct  206  ----------QDVNECAT-ENPCVQ-TCVNTYGSFICRCDPGYELEEDGVHCSDMDECSF  253

Query  913  SPDLCGSGTCVNTPGSFECECFDGYESGFMMM---KNCMDIDECE-RNPLLCRGGTCVNT  968
            S  LC    CVN PG++ C C      G++++   ++C DI+ECE RN       TC N 
Sbjct  254  SEFLC-QHECVNQPGTYFCSC----PPGYILLDDNRSCQDINECEHRNHTCNLQQTCYNL  308

Query  969  EGSFQCDCPL  978
            +G F+C  P+
Sbjct  309  QGGFKCIDPI  318


 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 91/360 (25%), Positives = 135/360 (38%), Gaps = 71/360 (20%)

Query  1689  EIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHP---CGNGTCKNTVGS  1745
              I  V    LC+   G+ +  C NGF   +    C+D+DEC   P    G+  C N  G 
Sbjct  6     RILTVTILALCLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGG  65

Query  1746  YNCL--CYPGFELTHNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGK  1803
             Y C+    P +   ++N                 +   +  I S   +C  GY++  +  
Sbjct  66    YLCIPRTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTI-SRPLICRFGYQMD-ESN  123

Query  1804  NCIDTNECVALPGSCSP-GTCQNLEGSFRCICPPGYEVKSESCIDINECNEDPNICLFGS  1862
              C+D +EC      C+P   C N EG + C C  GY +    C+DI+EC        +G 
Sbjct  124   QCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECR-------YGY  176

Query  1863  C----TNTPGGFQCICPTGFVLSDNGRRCFDTRQ--------SFCFTNFENGKCSVPKAF  1910
             C     N PG + C C  GF L+++GR C D  +          C   + +  C     +
Sbjct  177   CQQLCANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCVQTCVNTYGSFICRCDPGY  236

Query  1911  NTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESP  1970
                +    CS                                         D++EC  S 
Sbjct  237   ELEEDGVHCS-----------------------------------------DMDECSFSE  255

Query  1971  GVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGN--GTCTNVIGSFEC  2028
              +C +  C+N  G++ C CP GY L      C D +EC   N   N   TC N+ G F+C
Sbjct  256   FLCQH-ECVNQPGTYFCSCPPGYILLDDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKC  314


 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 68/228 (30%), Positives = 94/228 (41%), Gaps = 41/228 (18%)

Query  1441  DIDECQELPGLCQGGN-CINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTC  1499
             D+DEC      C     CINT G + C C  GY+L E    C DIDEC    G C    C
Sbjct  127   DVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQ--CLDIDEC--RYGYCQ-QLC  181

Query  1500  YNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTYNV  1559
              N  G+Y+C C P +     G +C D+ +           C  E P     + C  TY  
Sbjct  182   ANVPGSYSCTCNPGFTLNEDGRSCQDVNE-----------CATENP---CVQTCVNTYG-  226

Query  1560  GKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICANGVCINQI  1619
                                  IC   PG+  +       D+DEC     +C +  C+NQ 
Sbjct  227   -------------------SFICRCDPGYELEEDGVHCSDMDECSFSEFLCQHE-CVNQP  266

Query  1620  GSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRC  1667
             G++ C CP G+   D    C+DI+EC + ++ C     C N  G ++C
Sbjct  267   GTYFCSCPPGYILLDDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKC  314


 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 93/328 (28%), Positives = 129/328 (39%), Gaps = 57/328 (17%)

Query  1211  SVNAQCVNSPGSYLCACVEGFTGDGFT--CSDVDECAENVHLCE-NGQCLNVPGAYRCEC  1267
             ++ A C+ SPG+    C  GF  D  +  C D+DEC      C  +  C+N  G Y C  
Sbjct  11    TILALCLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLCIP  70

Query  1268  EMGFT---PASDSKSCQDINECSFQNICVFGTCNNLPGMFH-CICDDGYELDRTGGNCTD  1323
                     P S+  S        +       +  N P +    IC  GY++D +   C D
Sbjct  71    RTNPVYRGPYSNPYSTP--YSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESN-QCVD  127

Query  1324  VDECADPINCVN--GLCVNTPGRYECNCPPDFQLNPTGVGCVDN-RVGNCYLKYGPRGDG  1380
             VDECA   +  N   +C+NT G Y C+C   + L       +D  R G C  +      G
Sbjct  128   VDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYC-QQLCANVPG  186

Query  1381  SLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNPITIILE  1440
             S SC                          TC P              GF  N      +
Sbjct  187   SYSC--------------------------TCNP--------------GFTLNEDGRSCQ  206

Query  1441  DIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCY  1500
             D++EC       Q   C+NT+GSF C C  GY L E+   C D+DEC     +C    C 
Sbjct  207   DVNECATENPCVQ--TCVNTYGSFICRCDPGYELEEDGVHCSDMDECSFSEFLCQ-HECV  263

Query  1501  NTLGNYTCICPPEYMQVNGGHNCMDMRK  1528
             N  G Y C CPP Y+ ++   +C D+ +
Sbjct  264   NQPGTYFCSCPPGYILLDDNRSCQDINE  291


 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 88/305 (29%), Positives = 129/305 (42%), Gaps = 48/305 (16%)

Query  1737  GTCKNTVGSYNCLCYPGFELTHNN-DCMDIDECSSFFGQVCR-NGRCFNEIGSFKCLCNE  1794
               C  + G+    C  GF+L   +  C+DIDEC +   + CR +  C N+ G + C+   
Sbjct  14    ALCLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTI-PEACRGDMMCVNQNGGYLCIPRT  72

Query  1795  GYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFR-CICPPGYEV-KSESCIDINECN  1852
                      N   T      P +  P +  N     R  IC  GY++ +S  C+D++EC 
Sbjct  73    NPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESNQCVDVDECA  132

Query  1853  EDPNIC-LFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCS-VPKAF  1910
              D + C     C NT GG+ C C  G+ L +   +C D  +  C   +    C+ VP ++
Sbjct  133   TDSHQCNPTQICINTEGGYTCSCTDGYWLLEG--QCLDIDE--CRYGYCQQLCANVPGSY  188

Query  1911  NTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECL-ES  1969
             +       C+  PG    +    C                          +DVNEC  E+
Sbjct  189   S-------CTCNPGFTLNEDGRSC--------------------------QDVNECATEN  215

Query  1970  PGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGNGTCTNVIGSFECN  2029
             P V +   C+NT GSF C C  GY L+  GVHC D DECS         C N  G++ C+
Sbjct  216   PCVQT---CVNTYGSFICRCDPGYELEEDGVHCSDMDECSFSEFLCQHECVNQPGTYFCS  272

Query  2030  CHEGF  2034
             C  G+
Sbjct  273   CPPGY  277


 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 53/100 (53%), Gaps = 3/100 (3%)

Query  52   CRRGFIPNIRTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDID  111
            C  GF  N    +CQDV+EC       Q   C+NT GS+ C+C  G++  E    C D+D
Sbjct  192  CNPGFTLNEDGRSCQDVNECATENPCVQ--TCVNTYGSFICRCDPGYELEEDGVHCSDMD  249

Query  112  ECSIIPGICEGSECSNTVGSYFCICPRGYVTSTDGSRCID  151
            ECS    +C+  EC N  G+YFC CP GY+   D   C D
Sbjct  250  ECSFSEFLCQ-HECVNQPGTYFCSCPPGYILLDDNRSCQD  288


 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 80/260 (31%), Positives = 108/260 (42%), Gaps = 45/260 (17%)

Query  1291  ICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDECADPINCVNG--LCVNTPGRYECN  1348
             + +   C   PG     C +G++LDR  G C D+DEC        G  +CVN  G Y C 
Sbjct  10    VTILALCLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLC-  68

Query  1349  CPPDFQLNPTGVGCVDNRVGNCY------------LKYGPRGDGSLSCNTEIGVGVSRSS  1396
              P   + NP   G   N     Y                P     L C    G  +  S+
Sbjct  69    IP---RTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLIC--RFGYQMDESN  123

Query  1397  CC-----CSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNPITIILE----DIDECQE  1447
              C     C+      NP + C    +TE    C   +G+       +LE    DIDEC+ 
Sbjct  124   QCVDVDECATDSHQCNPTQIC---INTEGGYTCSCTDGY------WLLEGQCLDIDECRY  174

Query  1448  LPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVA-HPGVCGPGTCYNTLGNY  1506
               G CQ   C N  GS+ C C  G+ L+E+ R C+D++EC   +P V    TC NT G++
Sbjct  175   --GYCQQL-CANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCV---QTCVNTYGSF  228

Query  1507  TCICPPEYMQVNGGHNCMDM  1526
              C C P Y     G +C DM
Sbjct  229   ICRCDPGYELEEDGVHCSDM  248


 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 52/106 (49%), Gaps = 7/106 (7%)

Query  47   AQPQPCRRGFIPNIRTGACQDVDECQAIPGVCQGGN-CINTVGSYECKCPAGHKQNEATQ  105
            ++P  CR G+  +  +  C DVDEC      C     CINT G Y C C  G+   E   
Sbjct  108  SRPLICRFGYQMD-ESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEG--  164

Query  106  KCDDIDECSIIPGICEGSECSNTVGSYFCICPRGYVTSTDGSRCID  151
            +C DIDEC    G C+   C+N  GSY C C  G+  + DG  C D
Sbjct  165  QCLDIDECRY--GYCQ-QLCANVPGSYSCTCNPGFTLNEDGRSCQD  207


 Score = 48.9 bits (115),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 39/74 (53%), Gaps = 4/74 (5%)

Query  1962  DVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGNGTCTN  2021
             D++EC    G C    C N  GS+ C C  G+ L+  G  C D +EC+  NPC   TC N
Sbjct  168   DIDECRY--GYCQQ-LCANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCVQ-TCVN  223

Query  2022  VIGSFECNCHEGFE  2035
               GSF C C  G+E
Sbjct  224   TYGSFICRCDPGYE  237


> sp|Q9Y219|JAG2_HUMAN Protein jagged-2 OS=Homo sapiens GN=JAG2 
PE=1 SV=3
Length=1238

 Score = 127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 234/894 (26%), Positives = 356/894 (40%), Gaps = 181/894 (20%)

Query  1096  EYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTK-GSFICHCQLGYSVKKGTT  1154
              ++ L + G +A ++++  +  +E   ++    F    N   G + C      +   G  
Sbjct  177   RWKSLHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWM  236

Query  1155  GCTDVDECE--IGAHNCDMHASCVNVPGSFKCSCREGWVGNGI-KCIDLDECSNGTHQCS  1211
             G     EC+  +    C++      VPG  +C C  GW G    +C+    C +G+    
Sbjct  237   G----KECKEAVCKQGCNLLHGGCTVPG--ECRCSYGWQGRFCDECVPYPGCVHGSCVEP  290

Query  1212  VNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECAENVHLCENG-QCLNV-PGAYRCECEM  1269
                 C  + G  LC              D++ C  + H C NG  C+N  P  YRC C  
Sbjct  291   WQCNCETNWGGLLCD------------KDLNYCGSH-HPCTNGGTCINAEPDQYRCTCPD  337

Query  1270  GFTPASDSKSCQDINECSFQNICV-FGTCNNLPGMFHCICDDGYELDRTGGNCT-DVDEC  1327
             G++     ++C+        N C   G+C+ +P  F C C  G+    +G  C  D+DEC
Sbjct  338   GYS----GRNCEKAEHACTSNPCANGGSCHEVPSGFECHCPSGW----SGPTCALDIDEC  389

Query  1328  ADPINCVNGLCVNTPGRYECNCPPDF-----QLNPT---GVGCVD-----NRVGNCYLKY  1374
             A       G CV+    +EC CP  +     QL+     G  C++     N +G  Y   
Sbjct  390   ASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCKNLIGGYYCDC  449

Query  1375  GPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNP  1434
              P   G    N  I V   R  C        G  C+    VN   Y  +CP G G R   
Sbjct  450   IP---GWKGINCHINVNDCRGQC------QHGGTCKDL--VNG--YQCVCPRGFGGRHCE  496

Query  1435  ITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICE-DIDECVAHPGV  1493
             +     + DEC   P    GG C +    F C CP+G+       +CE D+D C   P  
Sbjct  497   L-----ERDECASSP-CHSGGLCEDLADGFHCHCPQGF----SGPLCEVDVDLCEPSPCR  546

Query  1494  CGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMC  1553
              G   CYN  G+Y C CP ++    GG NC                              
Sbjct  547   NG-ARCYNLEGDYYCACPDDF----GGKNC------------------------------  571

Query  1554  CCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICANG  1613
                       + P EPCP  G     + CG+                D    +PG  A+G
Sbjct  572   ----------SVPREPCPG-GACRVIDGCGS----------------DAGPGMPGTAASG  604

Query  1614  V------CINQI-GSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYR  1666
             V      C++Q  G+F C C +GF+        E+ID+C      C+    CI+   ++R
Sbjct  605   VCGPHGRCVSQPGGNFSCICDSGFTGT---YCHENIDDCLG--QPCRNGGTCIDEVDAFR  659

Query  1667  CECAAGFKLSPNGACVDRNECLEIPNVC-SHGLCVDMQGSYKCICHNGFKASQDQTMCMD  1725
             C C +G++    G   D N    +P+ C S G C D+   + C C +G+K    +T    
Sbjct  660   CFCPSGWE----GELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKG---KTCHSR  712

Query  1726  VDECERHPCGN-GTCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSFFGQVCRNGRCFNE  1784
               +C+ + C N GTC ++  ++ C C PG++    + C      S         G C   
Sbjct  713   EFQCDAYTCSNGGTCYDSGDTFRCACPPGWK---GSTCAVAKNSSCLPNPCVNGGTCVGS  769

Query  1785  IGSFKCLCNEGYELTLDGKNCI-DTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSE  1843
               SF C+C +G+E    G+ C  +TN+C  LP   + G C +    FRC C PG+    +
Sbjct  770   GASFSCICRDGWE----GRTCTHNTNDCNPLP-CYNGGICVDGVNWFRCECAPGF-AGPD  823

Query  1844  SCIDINECNEDPNICLFGS-CTNTPGGFQCICPTGFV------LSDNGRRCFDTRQSFCF  1896
               I+I+EC   P  C +G+ C +   G++C CP G        +   GR C+     F  
Sbjct  824   CRINIDECQSSP--CAYGATCVDEINGYRCSCPPGRAGPRCQEVIGFGRSCWSRGTPFPH  881

Query  1897  TNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGH  1950
              +     C+  +  +  +    CSK+   GW  PC L  + E ++ Q  CP G 
Sbjct  882   GSSWVEDCNSCRCLDGRRD---CSKV-WCGW-KPCLLAGQPEALSAQ--CPLGQ  928


 Score = 102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 165/603 (27%), Positives = 237/603 (39%), Gaps = 94/603 (16%)

Query  831   CPKPDTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNG-KCRNTIGSFKC  889
             C   +  +Y   CP G          +GR   K  + C   P  C NG  C      F+C
Sbjct  323   CINAEPDQYRCTCPDG---------YSGRNCEKAEHACTSNP--CANGGSCHEVPSGFEC  371

Query  890   KCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMD  949
              C SG++         DIDEC  +P   G GTCV+    FEC C + +      +    D
Sbjct  372   HCPSGWS---GPTCALDIDECASNPCAAG-GTCVDQVDGFECICPEQWVGATCQL----D  423

Query  950   IDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNG-KCV  1008
              +ECE  P L    +C N  G + CDC  G +        I+VN+C      C++G  C 
Sbjct  424   ANECEGKPCL-NAFSCKNLIGGYYCDCIPGWKGINCH---INVNDCR---GQCQHGGTCK  476

Query  1009  NMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHT--HCTNSEGSYECSCSDGYALM  1066
             ++V  YQC C  G+     R    + DEC   +  CH+   C +    + C C  G++  
Sbjct  477   DLVNGYQCVCPRGFGG---RHCELERDECA--SSPCHSGGLCEDLADGFHCHCPQGFS--  529

Query  1067  PDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMA---SMDMK-----TCIDVN  1118
                    D+D CE +P   +G +C N+ G+Y C C D F     S+  +      C  ++
Sbjct  530   -GPLCEVDVDLCEPSP-CRNGARCYNLEGDYYCACPDDFGGKNCSVPREPCPGGACRVID  587

Query  1119  ECDLNSNICMFGEC------------ENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGA  1166
              C  ++   M G                  G+F C C  G++   GT    ++D+C    
Sbjct  588   GCGSDAGPGMPGTAASGVCGPHGRCVSQPGGNFSCICDSGFT---GTYCHENIDDCL--G  642

Query  1167  HNCDMHASCVNVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCA  1226
               C    +C++   +F+C C  GW G   +  D +        C    +C +    + CA
Sbjct  643   QPCRNGGTCIDEVDAFRCFCPSGWEG---ELCDTNPNDCLPDPCHSRGRCYDLVNDFYCA  699

Query  1227  CVEGFTGDGFTCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINEC  1286
             C +G+ G   TC   +   +       G C +    +RC C  G+     S      N  
Sbjct  700   CDDGWKGK--TCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGW---KGSTCAVAKNSS  754

Query  1287  SFQNICV-FGTCNNLPGMFHCICDDGYELDRTGGNCTDVDECADPINCVN-GLCVNTPGR  1344
                N CV  GTC      F CIC DG+E    G  CT      +P+ C N G+CV+    
Sbjct  755   CLPNPCVNGGTCVGSGASFSCICRDGWE----GRTCTHNTNDCNPLPCYNGGICVDGVNW  810

Query  1345  YECNCPPDF------------QLNP--TGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGV  1390
             + C C P F            Q +P   G  CVD   G  Y    P G     C   IG 
Sbjct  811   FRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEING--YRCSCPPGRAGPRCQEVIGF  868

Query  1391  GVS  1393
             G S
Sbjct  869   GRS  871


 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 185/692 (27%), Positives = 265/692 (38%), Gaps = 137/692 (20%)

Query  486   RVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYG-FGEPCHPCPA----KNS  540
             + C+D  M   C   + K  C     G     EC C+    G F + C P P        
Sbjct  229   KACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSCV  288

Query  541   AEFHGLCSSGIGITVDGRDINECALDPDICSNGICENLR-GSYRCNCNSGYEPDPSGRNC  599
               +   C +  G  +  +D+N C       + G C N     YRC C  GY    SGRNC
Sbjct  289   EPWQCNCETNWGGLLCDKDLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGY----SGRNC  344

Query  600   VDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFST---ETDTCE--------------  642
                +    +    + G C   P  + C CP G+   T   + D C               
Sbjct  345   EKAEHACTSNPCANGGSCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQV  404

Query  643   ------------------DINECESSPCVNG-ACRNNLGSFNCECSPGSKLDSTGLIC--  681
                               D NECE  PC+N  +C+N +G + C+C PG K    G+ C  
Sbjct  405   DGFECICPEQWVGATCQLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWK----GINCHI  460

Query  682   -IDSLKGTCWLNIQDSRCEVNINGAT-------------LKSECCATLGAAWGSPCERCE  727
              ++  +G C        C+  +NG               L+ + CA+     G  CE   
Sbjct  461   NVNDCRGQC---QHGGTCKDLVNGYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLA  517

Query  728   --LDTACSRGFARVNGVTCE-DVNECDVFPGVCPNG-RCINSRGSFHCECPEGLTLDGTG  783
                   C +GF+   G  CE DV+ C+  P  C NG RC N  G ++C CP+    D  G
Sbjct  518   DGFHCHCPQGFS---GPLCEVDVDLCE--PSPCRNGARCYNLEGDYYCACPD----DFGG  568

Query  784   RVCLDIRMEQCYLTWDEDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALC  843
             + C  +  E C             PG        C V    GSD      P T       
Sbjct  569   KNC-SVPREPC-------------PGG------ACRVIDGCGSDAGP-GMPGTAASGVCG  607

Query  844   PRGPGFSNRG--------DILTGRPFYKDINECKVFPGMCMN-GKCRNTIGSFKCKCNSG  894
             P G   S  G           TG   +++I++C   P  C N G C + + +F+C C SG
Sbjct  608   PHGRCVSQPGGNFSCICDSGFTGTYCHENIDDCLGQP--CRNGGTCIDEVDAFRCFCPSG  665

Query  895   FTLDMEERNCTDIDECWISPDLCGS-GTCVNTPGSFECECFDGYESGFMMMKNCMDIDEC  953
             +  ++ + N  D       PD C S G C +    F C C DG++      K C    E 
Sbjct  666   WEGELCDTNPND-----CLPDPCHSRGRCYDLVNDFYCACDDGWKG-----KTCHS-REF  714

Query  954   ERNPLLCR-GGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVG  1012
             + +   C  GGTC ++  +F+C CP G + S      +  N   L +     G CV    
Sbjct  715   QCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTC---AVAKNSSCLPNPCVNGGTCVGSGA  771

Query  1013  TYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTC  1072
             ++ C C  G++      +  D +     NGG    C +    + C C+ G+A  PD R  
Sbjct  772   SFSCICRDGWEGRTCTHNTNDCNPLPCYNGGI---CVDGVNWFRCECAPGFA-GPDCRI-  826

Query  1073  ADIDECESNPDICDGGQCTNIPGEYRCLCYDG  1104
              +IDEC+S+P    G  C +    YRC C  G
Sbjct  827   -NIDECQSSP-CAYGATCVDEINGYRCSCPPG  856


 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 137/489 (28%), Positives = 196/489 (40%), Gaps = 87/489 (18%)

Query  1591  DIHSGKAVDIDECKEIPGICANGVCINQIGS-FRCECPTGFSYNDLLLVCEDIDECSNGD  1649
             D +SG+  +  E       CANG   +++ S F C CP+G+S     L   DIDEC++  
Sbjct  337   DGYSGRNCEKAEHACTSNPCANGGSCHEVPSGFECHCPSGWSGPTCAL---DIDECAS--  391

Query  1650  NLCQRNADCINSPGSYRCECAAGFKLSPNGAC--VDRNECLEIPNVCSHGLCVDMQGSYK  1707
             N C     C++    + C C   +     GA   +D NEC   P + +   C ++ G Y 
Sbjct  392   NPCAAGGTCVDQVDGFECICPEQWV----GATCQLDANECEGKPCLNAFS-CKNLIGGYY  446

Query  1708  CICHNGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCMDIDE  1767
             C C  G+K        ++V++C       GTCK+ V  Y C+C  GF   H    ++ DE
Sbjct  447   CDCIPGWKGINCH---INVNDCRGQCQHGGTCKDLVNGYQCVCPRGFGGRHCE--LERDE  501

Query  1768  CSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNC-IDTNECVALPGSCSPGT-CQN  1825
             C+S        G C +    F C C +G+     G  C +D + C   P  C  G  C N
Sbjct  502   CAS--SPCHSGGLCEDLADGFHCHCPQGFS----GPLCEVDVDLCE--PSPCRNGARCYN  553

Query  1826  LEGSFRCICPPGYEVKS----------ESCIDINECNEDPNICL-----------FGSCT  1864
             LEG + C CP  +  K+           +C  I+ C  D    +            G C 
Sbjct  554   LEGDYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGTAASGVCGPHGRCV  613

Query  1865  NTPGG-FQCICPTGFVLS--------------DNGRRCFDTRQSFCFTNFENGKCSVPKA  1909
             + PGG F CIC +GF  +               NG  C D   +F        +C  P  
Sbjct  614   SQPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAF--------RCFCPSG  665

Query  1910  FNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLES  1969
             +        C   P +   DPC    +  ++     C    G       +RE   +    
Sbjct  666   WEGEL----CDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAY--  719

Query  1970  PGVCSN-GHCINTDGSFRCECPMGYNLDYTGVHCIDTDECS-IGNPCGN-GTCTNVIGSF  2026
                CSN G C ++  +FRC CP G+     G  C      S + NPC N GTC     SF
Sbjct  720   --TCSNGGTCYDSGDTFRCACPPGWK----GSTCAVAKNSSCLPNPCVNGGTCVGSGASF  773

Query  2027  ECNCHEGFE  2035
              C C +G+E
Sbjct  774   SCICRDGWE  782


 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 147/521 (28%), Positives = 200/521 (38%), Gaps = 131/521 (25%)

Query  1597  AVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNA  1656
             A+DIDEC   P   A G C++Q+  F C CP  +      L   D +EC      C    
Sbjct  383   ALDIDECASNP-CAAGGTCVDQVDGFECICPEQWVGATCQL---DANECEG--KPCLNAF  436

Query  1657  DCINSPGSYRCECAAGFK--------------LSPNGACVD-------------------  1683
              C N  G Y C+C  G+K                  G C D                   
Sbjct  437   SCKNLIGGYYCDCIPGWKGINCHINVNDCRGQCQHGGTCKDLVNGYQCVCPRGFGGRHCE  496

Query  1684  --RNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMC-MDVDECERHPCGNGT-C  1739
               R+EC   P   S GLC D+   + C C  GF       +C +DVD CE  PC NG  C
Sbjct  497   LERDECASSP-CHSGGLCEDLADGFHCHCPQGFSGP----LCEVDVDLCEPSPCRNGARC  551

Query  1740  KNTVGSYNCLCYPGF---------ELTHNNDCMDIDECSSFFGQ---------VC-RNGR  1780
              N  G Y C C   F         E      C  ID C S  G          VC  +GR
Sbjct  552   YNLEGDYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGTAASGVCGPHGR  611

Query  1781  CFNEIG-SFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYE  1839
             C ++ G +F C+C+ G+  T   +N    ++C+  P   + GTC +   +FRC CP G+E
Sbjct  612   CVSQPGGNFSCICDSGFTGTYCHEN---IDDCLGQPCR-NGGTCIDEVDAFRCFCPSGWE  667

Query  1840  VKSESCIDINECNEDPNICL------FGSCTNTPGGFQCICPTGF--------------V  1879
              +         C+ +PN CL       G C +    F C C  G+               
Sbjct  668   GEL--------CDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAY  719

Query  1880  LSDNGRRCFDTRQSF---CFTNFENGKCSVPKAFNTTKAKCCCSKM-PGEGWGDPCELCP  1935
                NG  C+D+  +F   C   ++   C+V K  +     C       G G         
Sbjct  720   TCSNGGTCYDSGDTFRCACPPGWKGSTCAVAKNSSCLPNPCVNGGTCVGSG---------  770

Query  1936  KEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNGH-CINTDGSFRCECPMGYN  1994
                  +F  +C  G        +T    N+C  +P  C NG  C++    FRCEC  G+ 
Sbjct  771   ----ASFSCICRDGWEGRTCTHNT----NDC--NPLPCYNGGICVDGVNWFRCECAPGF-  819

Query  1995  LDYTGVHC-IDTDECSIGNPCGNG-TCTNVIGSFECNCHEG  2033
                 G  C I+ DEC   +PC  G TC + I  + C+C  G
Sbjct  820   ---AGPDCRINIDECQ-SSPCAYGATCVDEINGYRCSCPPG  856


 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 125/453 (28%), Positives = 180/453 (40%), Gaps = 55/453 (12%)

Query  67   DVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICE-GSEC  125
            D +EC+  P +    +C N +G Y C C  G K        +D        G C+ G  C
Sbjct  423  DANECEGKPCL-NAFSCKNLIGGYYCDCIPGWKGINCHINVNDCR------GQCQHGGTC  475

Query  126  SNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQELPGRFTKRQCCCESGR  185
             + V  Y C+CPRG+     G  C  +R     S   +G   ++L   F    C C  G 
Sbjct  476  KDLVNGYQCVCPRGF----GGRHCELERDECASSPCHSGGLCEDLADGF---HCHCPQGF  528

Query  186  CWAMGSVP----EMCPVRGSDEYRRLCVDGAPAGGGSRGGGT---------GGNGFLPSG  232
               +  V     E  P R       L  D   A     GG           GG   +  G
Sbjct  529  SGPLCEVDVDLCEPSPCRNGARCYNLEGDYYCACPDDFGGKNCSVPREPCPGGACRVIDG  588

Query  233  NGNGHGHGPRGAGFIPIPGSNGFSPGVGGAGVGTGSSTGNGPIITGLTILNQTIDICKHH  292
             G+  G G  G     + G +G      G        +G     TG T  ++ ID C   
Sbjct  589  CGSDAGPGMPGTAASGVCGPHGRCVSQPGGNFSCICDSG----FTG-TYCHENIDDCLGQ  643

Query  293  PDLCLN-GRCIPTLSSYRCECNMGYKQDSNGDCTDVDECTSNPC-SNGDCVNTPGSYYCK  350
            P  C N G CI  + ++RC C  G++ +     T+ ++C  +PC S G C +    +YC 
Sbjct  644  P--CRNGGTCIDEVDAFRCFCPSGWEGELCD--TNPNDCLPDPCHSRGRCYDLVNDFYCA  699

Query  351  CHAGFQRTPTKQACIDIDECIQNGVLCKN-GRCVNTDGSFQCICNAGFELTTDGKNCVDH  409
            C  G++           D        C N G C ++  +F+C C  G++ +T     V  
Sbjct  700  CDDGWKGKTCHSREFQCD-----AYTCSNGGTCYDSGDTFRCACPPGWKGSTCA---VAK  751

Query  410  DECTTTNMCLN-GMCINEDGSFKCICKPGFVLAPNGRYCT-DIDECQTSGICMNGHCINT  467
            +     N C+N G C+    SF CIC+ G+     GR CT + ++C        G C++ 
Sbjct  752  NSSCLPNPCVNGGTCVGSGASFSCICRDGW----EGRTCTHNTNDCNPLPCYNGGICVDG  807

Query  468  EGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGG  500
               FRCEC PG A G D R+ +D    S C  G
Sbjct  808  VNWFRCECAPGFA-GPDCRINIDECQSSPCAYG  839


 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 98/203 (48%), Gaps = 22/203 (11%)

Query  287  DICKHHPDLCL------NGRCIPTLSSYRCECNMGYKQDSNGDCTDVD-ECTSNPCSNG-  338
            ++C  +P+ CL       GRC   ++ + C C+ G+K  +   C   + +C +  CSNG 
Sbjct  669  ELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKT---CHSREFQCDAYTCSNGG  725

Query  339  DCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFE  398
             C ++  ++ C C  G++ +    A      C+ N  +   G CV +  SF CIC  G+E
Sbjct  726  TCYDSGDTFRCACPPGWKGSTC--AVAKNSSCLPNPCV-NGGTCVGSGASFSCICRDGWE  782

Query  399  LTTDGKNCVDHDECTTTNMCLNG-MCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTSG  457
                G+ C  +        C NG +C++    F+C C PGF   P+ R   +IDECQ+S 
Sbjct  783  ----GRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFA-GPDCR--INIDECQSSP  835

Query  458  ICMNGHCINTEGSFRCECPPGLA  480
                  C++    +RC CPPG A
Sbjct  836  CAYGATCVDEINGYRCSCPPGRA  858


 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 178/723 (25%), Positives = 257/723 (36%), Gaps = 184/723 (25%)

Query  288  ICKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNGDCTDVDECTSNP-CSNGDCVNTPGS  346
            +CK   +L   G  +P      C C+ G++          DEC   P C +G CV     
Sbjct  244  VCKQGCNLLHGGCTVPG----ECRCSYGWQGRF------CDECVPYPGCVHGSCVEP---  290

Query  347  YYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTD-GSFQCICNAGFELTTDGKN  405
            + C C   +      +   D++ C  +      G C+N +   ++C C  G+     G+N
Sbjct  291  WQCNCETNWGGLLCDK---DLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGYS----GRN  343

Query  406  CVDHDECTTTNMCLNGMCINEDGS-FKCICKPGFVLAPNGRYCT-DIDECQTSGICMNGH  463
            C   +   T+N C NG   +E  S F+C C  G+    +G  C  DIDEC ++     G 
Sbjct  344  CEKAEHACTSNPCANGGSCHEVPSGFECHCPSGW----SGPTCALDIDECASNPCAAGGT  399

Query  464  CINTEGSFRCECPPGLAVGV--------DGRVCVDTHMRSTCYGGIK-------------  502
            C++    F C CP               +G+ C++        GG               
Sbjct  400  CVDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGINCH  459

Query  503  ------KGACVR--PFPGAVTKSECCCANPDYGFG-------------EPCHPCPA-KNS  540
                  +G C         V   +C C     GFG              PCH     ++ 
Sbjct  460  INVNDCRGQCQHGGTCKDLVNGYQCVCPR---GFGGRHCELERDECASSPCHSGGLCEDL  516

Query  541  AE-FHGLCSSGIGITVDGRDINECALDPDICSNGI-CENLRGSYRC---------NCNSG  589
            A+ FH  C  G    +   D++ C  +P  C NG  C NL G Y C         NC+  
Sbjct  517  ADGFHCHCPQGFSGPLCEVDVDLC--EPSPCRNGARCYNLEGDYYCACPDDFGGKNCSVP  574

Query  590  YEPDPSGRNCVDIDEC-----------SVNRLLCDNGLCRNTP-GSYSCTCPKGYVFSTE  637
             EP P G  C  ID C           + + +   +G C + P G++SC C  G+   T 
Sbjct  575  REPCPGGA-CRVIDGCGSDAGPGMPGTAASGVCGPHGRCVSQPGGNFSCICDSGF---TG  630

Query  638  TDTCEDINECESSPCVNGA-CRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDS  696
            T   E+I++C   PC NG  C + + +F C C  G + +       D L   C       
Sbjct  631  TYCHENIDDCLGQPCRNGGTCIDEVDAFRCFCPSGWEGELCDTNPNDCLPDPC---HSRG  687

Query  697  RCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVNGVTCEDVN-ECDVFPG  755
            RC   +N                       +   AC  G+    G TC     +CD +  
Sbjct  688  RCYDLVN-----------------------DFYCACDDGW---KGKTCHSREFQCDAY--  719

Query  756  VCPN-GRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRMD  814
             C N G C +S  +F C CP G      G  C   +   C            +P      
Sbjct  720  TCSNGGTCYDSGDTFRCACPPGW----KGSTCAVAKNSSC------------LPNPCVNG  763

Query  815  ACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGM  874
              C   GA++   C                         D   GR    + N+C   P  
Sbjct  764  GTCVGSGASFSCICR------------------------DGWEGRTCTHNTNDCNPLP--  797

Query  875  CMNGK-CRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECEC  933
            C NG  C + +  F+C+C  GF       N   IDEC  SP   G+ TCV+    + C C
Sbjct  798  CYNGGICVDGVNWFRCECAPGFAGPDCRIN---IDECQSSPCAYGA-TCVDEINGYRCSC  853

Query  934  FDG  936
              G
Sbjct  854  PPG  856


> sp|Q14246|EMR1_HUMAN EGF-like module-containing mucin-like hormone 
receptor-like 1 OS=Homo sapiens GN=EMR1 PE=2 SV=3
Length=886

 Score = 122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 98/267 (37%), Positives = 128/267 (48%), Gaps = 40/267 (15%)

Query  1129  FGECENTKGSFICHCQLGYSVKKGT-------TGCTDVDECEIGAHNCDMHASCVNVPGS  1181
             +  C NT  S+ C C+ G+    G          C D+DEC      C  ++SC N+ G 
Sbjct  44    YATCTNTVDSYYCACKQGFLSSNGQNHFKDPGVRCKDIDECSQSPQPCGPNSSCKNLSGR  103

Query  1182  FKCSCREG--------WV----GNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVE  1229
             +KCSC +G        WV    GN   C D++EC   +  C  ++ CVNS GSY C+C  
Sbjct  104   YKCSCLDGFSSPTGNDWVPGKPGN-FSCTDINECLTSS-VCPEHSDCVNSMGSYSCSCQV  161

Query  1230  GFTGDGFTCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASD-------SKSCQD  1282
             GF     TC DVDECA+     E+  C N  G Y C C  GF  +S          SC+D
Sbjct  162   GFISRNSTCEDVDECADPRACPEHATCNNTVGNYSCFCNPGFESSSGHLSFQGLKASCED  221

Query  1283  INECSFQNIC-VFGTCNNLPGMFHCICDDGY-----ELDRT--GGNCTDVDEC-ADPINC  1333
             I+EC+   +C +  TC N PG + C C  G+     +L+ T  G  C D+DEC  DP  C
Sbjct  222   IDECT--EMCPINSTCTNTPGSYFCTCHPGFAPSNGQLNFTDQGVECRDIDECRQDPSTC  279

Query  1334  -VNGLCVNTPGRYECNCPPDFQLNPTG  1359
               N +C N  G Y C C   F  NP G
Sbjct  280   GPNSICTNALGSYSCGCIAGFHPNPEG  306


 Score = 117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 98/266 (37%), Positives = 125/266 (47%), Gaps = 44/266 (17%)

Query  1611  ANGVCINQIGSFRCECPTGF-------SYNDLLLVCEDIDECSNGDNLCQRNADCINSPG  1663
             A   C N + S+ C C  GF        + D  + C+DIDECS     C  N+ C N  G
Sbjct  43    AYATCTNTVDSYYCACKQGFLSSNGQNHFKDPGVRCKDIDECSQSPQPCGPNSSCKNLSG  102

Query  1664  SYRCECAAGFKLSPNG-----------ACVDRNECLEIPNVCSHGLCVDMQGSYKCICHN  1712
              Y+C C  GF  SP G           +C D NECL       H  CV+  GSY C C  
Sbjct  103   RYKCSCLDGFS-SPTGNDWVPGKPGNFSCTDINECLTSSVCPEHSDCVNSMGSYSCSCQV  161

Query  1713  GFKASQDQTMCMDVDECE--RHPCGNGTCKNTVGSYNCLCYPGFELTHNN--------DC  1762
             GF  S++ T C DVDEC   R    + TC NTVG+Y+C C PGFE +  +         C
Sbjct  162   GF-ISRNST-CEDVDECADPRACPEHATCNNTVGNYSCFCNPGFESSSGHLSFQGLKASC  219

Query  1763  MDIDECSSFFGQVC-RNGRCFNEIGSFKCLCNEGYE-------LTLDGKNCIDTNECVAL  1814
              DIDEC+    ++C  N  C N  GS+ C C+ G+         T  G  C D +EC   
Sbjct  220   EDIDECT----EMCPINSTCTNTPGSYFCTCHPGFAPSNGQLNFTDQGVECRDIDECRQD  275

Query  1815  PGSCSPGT-CQNLEGSFRCICPPGYE  1839
             P +C P + C N  GS+ C C  G+ 
Sbjct  276   PSTCGPNSICTNALGSYSCGCIAGFH  301


 Score = 108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 91/288 (32%), Positives = 129/288 (45%), Gaps = 42/288 (15%)

Query  979   GHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQAT--------PDRRS  1030
             GH + P+R+     N C  S        C N V +Y C+C  G+ ++        P  R 
Sbjct  20    GH-IRPTRKPNTKGNNCRDSTLCPAYATCTNTVDSYYCACKQGFLSSNGQNHFKDPGVR-  77

Query  1031  CTDIDECMIMNGGC--HTHCTNSEGSYECSCSDGYAL---------MPDVRTCADIDECE  1079
             C DIDEC      C  ++ C N  G Y+CSC DG++           P   +C DI+EC 
Sbjct  78    CKDIDECSQSPQPCGPNSSCKNLSGRYKCSCLDGFSSPTGNDWVPGKPGNFSCTDINECL  137

Query  1080  SNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSF  1139
             ++    +   C N  G Y C C  GF++     TC DV+EC           C NT G++
Sbjct  138   TSSVCPEHSDCVNSMGSYSCSCQVGFISRNS--TCEDVDECADPRACPEHATCNNTVGNY  195

Query  1140  ICHCQLGYSVKKG-------TTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWV-  1191
              C C  G+    G          C D+DEC      C ++++C N PGS+ C+C  G+  
Sbjct  196   SCFCNPGFESSSGHLSFQGLKASCEDIDEC---TEMCPINSTCTNTPGSYFCTCHPGFAP  252

Query  1192  --------GNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGF  1231
                       G++C D+DEC      C  N+ C N+ GSY C C+ GF
Sbjct  253   SNGQLNFTDQGVECRDIDECRQDPSTCGPNSICTNALGSYSCGCIAGF  300


 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 121/261 (46%), Gaps = 38/261 (15%)

Query  920   GTCVNTPGSFECECFDGYES--GFMMMKN----CMDIDECERNPLLC-RGGTCVNTEGSF  972
              TC NT  S+ C C  G+ S  G    K+    C DIDEC ++P  C    +C N  G +
Sbjct  45    ATCTNTVDSYYCACKQGFLSSNGQNHFKDPGVRCKDIDECSQSPQPCGPNSSCKNLSGRY  104

Query  973   QCDC------PLGHELSPSRE---ECIDVNECSLSDSLC-RNGKCVNMVGTYQCSCNSGY  1022
             +C C      P G++  P +     C D+NEC L+ S+C  +  CVN +G+Y CSC  G+
Sbjct  105   KCSCLDGFSSPTGNDWVPGKPGNFSCTDINEC-LTSSVCPEHSDCVNSMGSYSCSCQVGF  163

Query  1023  QATPDRRSCTDIDECMIMNG-GCHTHCTNSEGSYECSCSDGY-------ALMPDVRTCAD  1074
              +     +C D+DEC        H  C N+ G+Y C C+ G+       +      +C D
Sbjct  164   IS--RNSTCEDVDECADPRACPEHATCNNTVGNYSCFCNPGFESSSGHLSFQGLKASCED  221

Query  1075  IDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKT-------CIDVNECDLNSNIC  1127
             IDEC     I     CTN PG Y C C+ GF  S            C D++EC  + + C
Sbjct  222   IDECTEMCPI--NSTCTNTPGSYFCTCHPGFAPSNGQLNFTDQGVECRDIDECRQDPSTC  279

Query  1128  MFGE-CENTKGSFICHCQLGY  1147
                  C N  GS+ C C  G+
Sbjct  280   GPNSICTNALGSYSCGCIAGF  300


 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 101/224 (45%), Gaps = 34/224 (15%)

Query  286  IDICKHHPDLC-LNGRCIPTLSSYRCECNMGYKQDSNGD----------CTDVDEC-TSN  333
            ID C   P  C  N  C      Y+C C  G+   +  D          CTD++EC TS+
Sbjct  81   IDECSQSPQPCGPNSSCKNLSGRYKCSCLDGFSSPTGNDWVPGKPGNFSCTDINECLTSS  140

Query  334  PC-SNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCI  392
             C  + DCVN+ GSY C C  GF        C D+DEC       ++  C NT G++ C 
Sbjct  141  VCPEHSDCVNSMGSYSCSCQVGF--ISRNSTCEDVDECADPRACPEHATCNNTVGNYSCF  198

Query  393  CNAGFE-----LTTDG--KNCVDHDECTTTNMC-LNGMCINEDGSFKCICKPGFV-----  439
            CN GFE     L+  G   +C D DECT   MC +N  C N  GS+ C C PGF      
Sbjct  199  CNPGFESSSGHLSFQGLKASCEDIDECT--EMCPINSTCTNTPGSYFCTCHPGFAPSNGQ  256

Query  440  --LAPNGRYCTDIDEC-QTSGIC-MNGHCINTEGSFRCECPPGL  479
                  G  C DIDEC Q    C  N  C N  GS+ C C  G 
Sbjct  257  LNFTDQGVECRDIDECRQDPSTCGPNSICTNALGSYSCGCIAGF  300


 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 95/211 (45%), Gaps = 33/211 (16%)

Query  299  GRCIPTLSSYRCECNMGYKQDSNGD---------CTDVDECTSNPCS---NGDCVNTPGS  346
              C  T+ SY C C  G+   SNG          C D+DEC+ +P     N  C N  G 
Sbjct  45   ATCTNTVDSYYCACKQGF-LSSNGQNHFKDPGVRCKDIDECSQSPQPCGPNSSCKNLSGR  103

Query  347  YYCKCHAGFQR---------TPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGF  397
            Y C C  GF            P   +C DI+EC+ + V  ++  CVN+ GS+ C C  GF
Sbjct  104  YKCSCLDGFSSPTGNDWVPGKPGNFSCTDINECLTSSVCPEHSDCVNSMGSYSCSCQVGF  163

Query  398  ELTTDGKNCVDHDECTTTNMC-LNGMCINEDGSFKCICKPGFV-----LAPNGRY--CTD  449
               +    C D DEC     C  +  C N  G++ C C PGF      L+  G    C D
Sbjct  164  --ISRNSTCEDVDECADPRACPEHATCNNTVGNYSCFCNPGFESSSGHLSFQGLKASCED  221

Query  450  IDECQTSGICMNGHCINTEGSFRCECPPGLA  480
            IDEC T    +N  C NT GS+ C C PG A
Sbjct  222  IDEC-TEMCPINSTCTNTPGSYFCTCHPGFA  251


 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 81/254 (32%), Positives = 121/254 (48%), Gaps = 51/254 (20%)

Query  558  RDINECALDPDICS-NGICENLRGSYRCNCNSGYEP---------DPSGRNCVDIDECSV  607
            +DI+EC+  P  C  N  C+NL G Y+C+C  G+            P   +C DI+EC  
Sbjct  79   KDIDECSQSPQPCGPNSSCKNLSGRYKCSCLDGFSSPTGNDWVPGKPGNFSCTDINECLT  138

Query  608  NRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINECESSPC--VNGACRNNLGSFN  665
            + +  ++  C N+ GSYSC+C  G++  +   TCED++EC        +  C N +G+++
Sbjct  139  SSVCPEHSDCVNSMGSYSCSCQVGFI--SRNSTCEDVDECADPRACPEHATCNNTVGNYS  196

Query  666  CECSPGSKLDSTGLICIDSLKGTCWLNIQD--SRCEVNINGATLKSECCATLGAAWGSPC  723
            C C+PG +  S+G +    LK +C  +I +    C +N       S C  T G+ + +  
Sbjct  197  CFCNPGFE-SSSGHLSFQGLKASC-EDIDECTEMCPIN-------STCTNTPGSYFCT--  245

Query  724  ERCELDTACSRGFARVN--------GVTCEDVNECDVFPGVC-PNGRCINSRGSFHCEC-  773
                    C  GFA  N        GV C D++EC   P  C PN  C N+ GS+ C C 
Sbjct  246  --------CHPGFAPSNGQLNFTDQGVECRDIDECRQDPSTCGPNSICTNALGSYSCGCI  297

Query  774  ------PEGLTLDG  781
                  PEG   DG
Sbjct  298  AGFHPNPEGSQKDG  311


 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 93/311 (30%), Positives = 133/311 (43%), Gaps = 65/311 (21%)

Query  1757  THNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKN--------CIDT  1808
             T  N+C D   C ++         C N + S+ C C +G+ L+ +G+N        C D 
Sbjct  30    TKGNNCRDSTLCPAY-------ATCTNTVDSYYCACKQGF-LSSNGQNHFKDPGVRCKDI  81

Query  1809  NECVALPGSCSP-GTCQNLEGSFRCICPPGYEVKS-----------ESCIDINECNEDPN  1856
             +EC   P  C P  +C+NL G ++C C  G+   +            SC DINEC     
Sbjct  82    DECSQSPQPCGPNSSCKNLSGRYKCSCLDGFSSPTGNDWVPGKPGNFSCTDINECLTSSV  141

Query  1857  ICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAK  1916
                   C N+ G + C C  GF+          +R S C    +  +C+ P+A       
Sbjct  142   CPEHSDCVNSMGSYSCSCQVGFI----------SRNSTCE---DVDECADPRA---CPEH  185

Query  1917  CCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNG  1976
               C+   G      C   P  E  +       GH +  G+  + ED++EC E   +  N 
Sbjct  186   ATCNNTVG---NYSCFCNPGFESSS-------GHLSFQGLKASCEDIDECTEMCPI--NS  233

Query  1977  HCINTDGSFRCECPMGY-----NLDYT--GVHCIDTDECSIG-NPCG-NGTCTNVIGSFE  2027
              C NT GS+ C C  G+      L++T  GV C D DEC    + CG N  CTN +GS+ 
Sbjct  234   TCTNTPGSYFCTCHPGFAPSNGQLNFTDQGVECRDIDECRQDPSTCGPNSICTNALGSYS  293

Query  2028  CNCHEGFEPGP  2038
             C C  GF P P
Sbjct  294   CGCIAGFHPNP  304


 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 94/298 (32%), Positives = 123/298 (41%), Gaps = 71/298 (24%)

Query  1210  CSVNAQCVNSPGSYLCACVEGFTGD---------GFTCSDVDECAENVHLC-ENGQCLNV  1259
             C   A C N+  SY CAC +GF            G  C D+DEC+++   C  N  C N+
Sbjct  41    CPAYATCTNTVDSYYCACKQGFLSSNGQNHFKDPGVRCKDIDECSQSPQPCGPNSSCKNL  100

Query  1260  PGAYRCECEMGFTPASDSK---------SCQDINECSFQNIC-VFGTCNNLPGMFHCICD  1309
              G Y+C C  GF+  + +          SC DINEC   ++C     C N  G + C C 
Sbjct  101   SGRYKCSCLDGFSSPTGNDWVPGKPGNFSCTDINECLTSSVCPEHSDCVNSMGSYSCSCQ  160

Query  1310  DGYELDRTGGNCTDVDECADPINC-VNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVG  1368
              G+ + R    C DVDECADP  C  +  C NT G Y C C P F+              
Sbjct  161   VGF-ISR-NSTCEDVDECADPRACPEHATCNNTVGNYSCFCNPGFE--------------  204

Query  1369  NCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNT----LC  1424
                        G LS     G+  S    C  +     + C    P+NST  NT     C
Sbjct  205   --------SSSGHLSFQ---GLKAS----CEDI-----DECTEMCPINSTCTNTPGSYFC  244

Query  1425  PGGEGFRPNPITIIL-------EDIDECQELPGLCQGGN--CINTFGSFQCECPKGYY  1473
                 GF P+   +          DIDEC++ P  C G N  C N  GS+ C C  G++
Sbjct  245   TCHPGFAPSNGQLNFTDQGVECRDIDECRQDPSTC-GPNSICTNALGSYSCGCIAGFH  301


 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 119/282 (42%), Gaps = 55/282 (20%)

Query  380  GRCVNTDGSFQCICNAGFELTTDGKN--------CVDHDECTTTNMC--LNGMCINEDGS  429
              C NT  S+ C C  GF L+++G+N        C D DEC+ +      N  C N  G 
Sbjct  45   ATCTNTVDSYYCACKQGF-LSSNGQNHFKDPGVRCKDIDECSQSPQPCGPNSSCKNLSGR  103

Query  430  FKCICKPGFVL---------APNGRYCTDIDECQTSGIC-MNGHCINTEGSFRCECPPGL  479
            +KC C  GF            P    CTDI+EC TS +C  +  C+N+ GS+ C C    
Sbjct  104  YKCSCLDGFSSPTGNDWVPGKPGNFSCTDINECLTSSVCPEHSDCVNSMGSYSCSC----  159

Query  480  AVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKN  539
             VG   R        STC   + + A  R  P   T     C N    +   C+P    +
Sbjct  160  QVGFISR-------NSTC-EDVDECADPRACPEHAT-----CNNTVGNYSCFCNPGFESS  206

Query  540  SAEFHGLCSSGIGITVDGRDINECALDPDICS-NGICENLRGSYRCNCNSGYEPD-----  593
            S        S  G+     DI+EC    ++C  N  C N  GSY C C+ G+ P      
Sbjct  207  SGHL-----SFQGLKASCEDIDECT---EMCPINSTCTNTPGSYFCTCHPGFAPSNGQLN  258

Query  594  --PSGRNCVDIDECSVNRLLC-DNGLCRNTPGSYSCTCPKGY  632
                G  C DIDEC  +   C  N +C N  GSYSC C  G+
Sbjct  259  FTDQGVECRDIDECRQDPSTCGPNSICTNALGSYSCGCIAGF  300


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 89/180 (49%), Gaps = 22/180 (12%)

Query  864   DINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLC-GSGTC  922
             DINEC        +  C N++GS+ C C  GF        C D+DEC   P  C    TC
Sbjct  132   DINECLTSSVCPEHSDCVNSMGSYSCSCQVGFI--SRNSTCEDVDEC-ADPRACPEHATC  188

Query  923   VNTPGSFECECFDGYES-----GFMMMK-NCMDIDEC-ERNPLLCRGGTCVNTEGSFQCD  975
              NT G++ C C  G+ES      F  +K +C DIDEC E  P+     TC NT GS+ C 
Sbjct  189   NNTVGNYSCFCNPGFESSSGHLSFQGLKASCEDIDECTEMCPI---NSTCTNTPGSYFCT  245

Query  976   C-----PLGHELSPSRE--ECIDVNECSLSDSLC-RNGKCVNMVGTYQCSCNSGYQATPD  1027
             C     P   +L+ + +  EC D++EC    S C  N  C N +G+Y C C +G+   P+
Sbjct  246   CHPGFAPSNGQLNFTDQGVECRDIDECRQDPSTCGPNSICTNALGSYSCGCIAGFHPNPE  305


 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 82/277 (30%), Positives = 113/277 (41%), Gaps = 55/277 (20%)

Query  1455  GNCINTFGSFQCECPKGY-------YLSEETRICEDIDECVAHPGVCGP-GTCYNTLGNY  1506
               C NT  S+ C C +G+       +  +    C+DIDEC   P  CGP  +C N  G Y
Sbjct  45    ATCTNTVDSYYCACKQGFLSSNGQNHFKDPGVRCKDIDECSQSPQPCGPNSSCKNLSGRY  104

Query  1507  TCICPPEYMQVNGG---------HNCMDMRK----------SFCYRSYNGTSCENELPFN  1547
              C C   +    G           +C D+ +          S C  S    SC  ++ F 
Sbjct  105   KCSCLDGFSSPTGNDWVPGKPGNFSCTDINECLTSSVCPEHSDCVNSMGSYSCSCQVGF-  163

Query  1548  VTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNI-----PGF-------TFDIHSG  1595
             +++   C      +  ++  +P   P  A   N  GN      PGF       +F     
Sbjct  164   ISRNSTC------EDVDECADPRACPEHATCNNTVGNYSCFCNPGFESSSGHLSFQGLKA  217

Query  1596  KAVDIDECKEIPGICANGVCINQIGSFRCECPTGFS-------YNDLLLVCEDIDECSNG  1648
                DIDEC E+  I  N  C N  GS+ C C  GF+       + D  + C DIDEC   
Sbjct  218   SCEDIDECTEMCPI--NSTCTNTPGSYFCTCHPGFAPSNGQLNFTDQGVECRDIDECRQD  275

Query  1649  DNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRN  1685
              + C  N+ C N+ GSY C C AGF  +P G+  D N
Sbjct  276   PSTCGPNSICTNALGSYSCGCIAGFHPNPEGSQKDGN  312


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 84/180 (47%), Gaps = 31/180 (17%)

Query  285  TIDICKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNGDCTDVDECTSNPCS---NGDCV  341
            T  +C  H D      C+ ++ SY C C +G+    N  C DVDEC ++P +   +  C 
Sbjct  138  TSSVCPEHSD------CVNSMGSYSCSCQVGFI-SRNSTCEDVDEC-ADPRACPEHATCN  189

Query  342  NTPGSYYCKCHAGFQRTP-------TKQACIDIDECIQNGVLCK-NGRCVNTDGSFQCIC  393
            NT G+Y C C+ GF+ +         K +C DIDEC +   +C  N  C NT GS+ C C
Sbjct  190  NTVGNYSCFCNPGFESSSGHLSFQGLKASCEDIDECTE---MCPINSTCTNTPGSYFCTC  246

Query  394  NAGFE-------LTTDGKNCVDHDECTTTNMC--LNGMCINEDGSFKCICKPGFVLAPNG  444
            + GF         T  G  C D DEC         N +C N  GS+ C C  GF   P G
Sbjct  247  HPGFAPSNGQLNFTDQGVECRDIDECRQDPSTCGPNSICTNALGSYSCGCIAGFHPNPEG  306


 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 115/278 (41%), Gaps = 41/278 (15%)

Query  1737  GTCKNTVGSYNCLCYPGFELT----HNND----CMDIDECSSFFGQVCRNGRCFNEIGSF  1788
              TC NTV SY C C  GF  +    H  D    C DIDECS        N  C N  G +
Sbjct  45    ATCTNTVDSYYCACKQGFLSSNGQNHFKDPGVRCKDIDECSQSPQPCGPNSSCKNLSGRY  104

Query  1789  KCLCNEGYEL-----TLDGK----NCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYE  1839
             KC C +G+        + GK    +C D NEC+          C N  GS+ C C  G+ 
Sbjct  105   KCSCLDGFSSPTGNDWVPGKPGNFSCTDINECLTSSVCPEHSDCVNSMGSYSCSCQVGFI  164

Query  1840  VKSESCIDINECNEDPNIC-LFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTN  1898
              ++ +C D++EC  DP  C    +C NT G + C C  GF  S +G   F   ++ C   
Sbjct  165   SRNSTCEDVDEC-ADPRACPEHATCNNTVGNYSCFCNPGFE-SSSGHLSFQGLKASCEDI  222

Query  1899  FE-NGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGID  1957
              E    C +      T     C+  PG          P   ++ F D          G++
Sbjct  223   DECTEMCPINSTCTNTPGSYFCTCHPG--------FAPSNGQLNFTD---------QGVE  265

Query  1958  DTREDVNECLESPGVCS-NGHCINTDGSFRCECPMGYN  1994
                 D++EC + P  C  N  C N  GS+ C C  G++
Sbjct  266   C--RDIDECRQDPSTCGPNSICTNALGSYSCGCIAGFH  301


 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 66/133 (50%), Gaps = 21/133 (16%)

Query  1599  DIDECKEIPGICANGVCINQIGSFRCECPTGF-------SYNDLLLVCEDIDECSNGDNL  1651
             D+DEC +      +  C N +G++ C C  GF       S+  L   CEDIDEC+    +
Sbjct  172   DVDECADPRACPEHATCNNTVGNYSCFCNPGFESSSGHLSFQGLKASCEDIDECTE---M  228

Query  1652  CQRNADCINSPGSYRCECAAGFKLSPNGA---------CVDRNECLEIPNVCS-HGLCVD  1701
             C  N+ C N+PGSY C C  GF  S NG          C D +EC + P+ C  + +C +
Sbjct  229   CPINSTCTNTPGSYFCTCHPGFAPS-NGQLNFTDQGVECRDIDECRQDPSTCGPNSICTN  287

Query  1702  MQGSYKCICHNGF  1714
               GSY C C  GF
Sbjct  288   ALGSYSCGCIAGF  300


 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 77/264 (29%), Positives = 107/264 (41%), Gaps = 57/264 (22%)

Query  1284  NECSFQNIC-VFGTCNNLPGMFHCICDDGY-------ELDRTGGNCTDVDECAD-PINC-  1333
             N C    +C  + TC N    ++C C  G+            G  C D+DEC+  P  C 
Sbjct  33    NNCRDSTLCPAYATCTNTVDSYYCACKQGFLSSNGQNHFKDPGVRCKDIDECSQSPQPCG  92

Query  1334  VNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVS  1393
              N  C N  GRY+C+C   F  +PTG   V  + GN             SC T+I   ++
Sbjct  93    PNSSCKNLSGRYKCSCLDGFS-SPTGNDWVPGKPGN------------FSC-TDINECLT  138

Query  1394  RSSC-----CCSLGKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNPITIILEDIDECQEL  1448
              S C     C +   ++   C+    V     N+ C               ED+DEC + 
Sbjct  139   SSVCPEHSDCVNSMGSYSCSCQ----VGFISRNSTC---------------EDVDECADP  179

Query  1449  PGLCQGGNCINTFGSFQCECPKGY-----YLSEE--TRICEDIDECVAHPGVCGPGTCYN  1501
                 +   C NT G++ C C  G+     +LS +     CEDIDEC     +    TC N
Sbjct  180   RACPEHATCNNTVGNYSCFCNPGFESSSGHLSFQGLKASCEDIDECTEMCPI--NSTCTN  237

Query  1502  TLGNYTCICPPEYMQVNGGHNCMD  1525
             T G+Y C C P +   NG  N  D
Sbjct  238   TPGSYFCTCHPGFAPSNGQLNFTD  261


 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 57/109 (52%), Gaps = 13/109 (12%)

Query  52   CRRGFIPNIRTGACQDVDECQAIPGVC-QGGNCINTVGSYECKC------PAGHKQNEAT  104
            C+ GFI   R   C+DVDEC A P  C +   C NTVG+Y C C       +GH   +  
Sbjct  159  CQVGFIS--RNSTCEDVDEC-ADPRACPEHATCNNTVGNYSCFCNPGFESSSGHLSFQGL  215

Query  105  Q-KCDDIDECSIIPGICEGSECSNTVGSYFCICPRGYVTSTDGSRCIDQ  152
            +  C+DIDEC+ +  I   S C+NT GSYFC C  G+  S       DQ
Sbjct  216  KASCEDIDECTEMCPI--NSTCTNTPGSYFCTCHPGFAPSNGQLNFTDQ  262


 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 47/81 (58%), Gaps = 2/81 (2%)

Query  64   ACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICEGS  123
            +C D++EC       +  +C+N++GSY C C  G     +T  C+D+DEC+      E +
Sbjct  129  SCTDINECLTSSVCPEHSDCVNSMGSYSCSCQVGFISRNST--CEDVDECADPRACPEHA  186

Query  124  ECSNTVGSYFCICPRGYVTST  144
             C+NTVG+Y C C  G+ +S+
Sbjct  187  TCNNTVGNYSCFCNPGFESSS  207


 Score = 50.4 bits (119),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 85/334 (25%), Positives = 127/334 (38%), Gaps = 69/334 (21%)

Query  581  SYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYV-------  633
            S+  +     +P+  G NC D   C           C NT  SY C C +G++       
Sbjct  17   SWEGHIRPTRKPNTKGNNCRDSTLCPAY------ATCTNTVDSYYCACKQGFLSSNGQNH  70

Query  634  FSTETDTCEDINECESSPC---VNGACRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCW  690
            F      C+DI+EC  SP     N +C+N  G + C C  G            S  G  W
Sbjct  71   FKDPGVRCKDIDECSQSPQPCGPNSSCKNLSGRYKCSCLDG----------FSSPTGNDW  120

Query  691  LNIQDSRCE-VNINGATL------KSECCATLGAAWGSPCERCELDTACSRGFARVNGVT  743
            +  +       +IN           S+C  ++G+             +C  GF   N  T
Sbjct  121  VPGKPGNFSCTDINECLTSSVCPEHSDCVNSMGS----------YSCSCQVGFISRNS-T  169

Query  744  CEDVNECDVFPGVCP-NGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDE  802
            CEDV+EC   P  CP +  C N+ G++ C C  G     +G +        C    D DE
Sbjct  170  CEDVDEC-ADPRACPEHATCNNTVGNYSCFCNPGFE-SSSGHLSFQGLKASCE---DIDE  224

Query  803  CIRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFY  862
            C    P    +++ C     ++   C     P   +          F+++G         
Sbjct  225  CTEMCP----INSTCTNTPGSYFCTCHPGFAPSNGQL--------NFTDQGVEC------  266

Query  863  KDINECKVFPGMC-MNGKCRNTIGSFKCKCNSGF  895
            +DI+EC+  P  C  N  C N +GS+ C C +GF
Sbjct  267  RDIDECRQDPSTCGPNSICTNALGSYSCGCIAGF  300


> sp|Q9UHX3|EMR2_HUMAN EGF-like module-containing mucin-like hormone 
receptor-like 2 OS=Homo sapiens GN=EMR2 PE=1 SV=2
Length=823

 Score = 117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 103/213 (48%), Gaps = 28/213 (13%)

Query  1003  RNGKCVNMVGTYQCSCNSGYQA-----TPDRRSCTDIDECMIMNG---GCHTHCTNSEGS  1054
             ++  CVN      C CN G+ +     T    +C DI+EC  ++    G  + C N+EGS
Sbjct  35    QDSSCVNATA---CRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGS  91

Query  1055  YECSCSDGYALMPDVRT--------CADIDECESNPDICDG-GQCTNIPGEYRCLCYDGF  1105
             Y+C CS GY  +   +T        C D+DEC+ NP +C   G C N  G Y C C  GF
Sbjct  92    YDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGF  151

Query  1106  -MASMDMKTCIDVNECDLNSNICMFG-ECENTKGSFICHCQLGYSVKKGT------TGCT  1157
              +   D K C DVNEC    N C     C N  GS+ C C+ G+    G+      T C 
Sbjct  152   KLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCE  211

Query  1158  DVDECEIGAHNCDMHASCVNVPGSFKCSCREGW  1190
             DVDEC  G H CD    C N  GS+ C CR GW
Sbjct  212   DVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGW  244


 Score = 103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/206 (37%), Positives = 111/206 (54%), Gaps = 27/206 (13%)

Query  1619  IGSFRCECPTGFS-YNDLLLV----CEDIDECSNGDNL-CQRNADCINSPGSYRCECAAG  1672
             + +  C C  GFS +++++      C+DI+EC+    + C + +DC N+ GSY C C+ G
Sbjct  40    VNATACRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPG  99

Query  1673  ---------FKLSPNGACVDRNECLEIPNVC-SHGLCVDMQGSYKCICHNGFKAS-QDQT  1721
                      FK      C D +EC + P +C S+G CV+  GSY C C  GFK   +D  
Sbjct  100   YEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPK  159

Query  1722  MCMDVDECE--RHPCGNGT-CKNTVGSYNCLCYPGFELT-------HNNDCMDIDECSSF  1771
             +C DV+EC   ++PC + T C N VGSY C C PG++         +N  C D+DECSS 
Sbjct  160   LCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSG  219

Query  1772  FGQVCRNGRCFNEIGSFKCLCNEGYE  1797
               Q   +  CFN +GS+ C C  G++
Sbjct  220   QHQCDSSTVCFNTVGSYSCRCRPGWK  245


 Score = 102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 99/200 (50%), Gaps = 25/200 (13%)

Query  1057  CSCSDGYALMPDV-----RTCADIDECESNPDICDG--GQCTNIPGEYRCLCYDGFMASM  1109
             C C+ G++   ++      TC DI+EC +   +  G    C N  G Y C+C  G+    
Sbjct  45    CRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVS  104

Query  1110  DMKT--------CIDVNECDLNSNICM-FGECENTKGSFICHCQLGYSVK-KGTTGCTDV  1159
               KT        C DV+EC  N  +C  +G C NT GS+ C C  G+ +K +    CTDV
Sbjct  105   GAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDV  164

Query  1160  DECEIGAHNCDMHASCVNVPGSFKCSCREGWVG--------NGIKCIDLDECSNGTHQCS  1211
             +EC  G + C     C+N  GS++C CR GW          N   C D+DECS+G HQC 
Sbjct  165   NECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCD  224

Query  1212  VNAQCVNSPGSYLCACVEGF  1231
              +  C N+ GSY C C  G+
Sbjct  225   SSTVCFNTVGSYSCRCRPGW  244


 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 92/182 (51%), Gaps = 22/182 (12%)

Query  1599  DIDECKEIPGICANGV--CINQIGSFRCECPTGFS--------YNDLLLVCEDIDECSNG  1648
             DI+EC  +  +       C N  GS+ C C  G+          N+    C+D+DEC   
Sbjct  67    DINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQN  126

Query  1649  DNLCQRNADCINSPGSYRCECAAGFKLSPN--GACVDRNECLEIPNVC-SHGLCVDMQGS  1705
               LC+    C+N+ GSY C+C  GFKL P     C D NEC    N C S   C++  GS
Sbjct  127   PRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGS  186

Query  1706  YKCICHNGFKA------SQDQTMCMDVDECE--RHPCGNGT-CKNTVGSYNCLCYPGFEL  1756
             Y+C C  G++         + T+C DVDEC   +H C + T C NTVGSY+C C PG++ 
Sbjct  187   YQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKP  246

Query  1757  TH  1758
              H
Sbjct  247   RH  248


 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 104/200 (52%), Gaps = 32/200 (16%)

Query  310  CECNMGYKQDSN------GDCTDVDEC-TSNPCSNG---DCVNTPGSYYCKCHAGFQ---  356
            C CN G+   S         C D++EC T +  S G   DC NT GSY C C  G++   
Sbjct  45   CRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVS  104

Query  357  -----RTPTKQACIDIDECIQNGVLCKN-GRCVNTDGSFQCICNAGFELT-TDGKNCVDH  409
                 +  ++  C D+DEC QN  LCK+ G CVNT GS+ C C  GF+L   D K C D 
Sbjct  105  GAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDV  164

Query  410  DECTT-TNMCLNGM-CINEDGSFKCICKPGFVLA------PNGRYCTDIDECQTSGICM-  460
            +ECT+  N C +   C+N  GS++C C+PG+         PN   C D+DEC +SG    
Sbjct  165  NECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDEC-SSGQHQC  223

Query  461  --NGHCINTEGSFRCECPPG  478
              +  C NT GS+ C C PG
Sbjct  224  DSSTVCFNTVGSYSCRCRPG  243


 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 98/198 (49%), Gaps = 22/198 (11%)

Query  847   PGFSNRGDILTGRPFYK--DINECKVFPGMC--MNGKCRNTIGSFKCKCNSGF-------  895
             PGFS+  +I+T  P     DINEC     +       C NT GS+ C C+ G+       
Sbjct  49    PGFSSFSEIIT-TPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAK  107

Query  896   TLDMEERN-CTDIDECWISPDLCGS-GTCVNTPGSFECECFDGYESGFMMMKNCMDIDEC  953
             T   E  N C D+DEC  +P LC S GTCVNT GS+ C+C  G++      K C D++EC
Sbjct  108   TFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNEC  167

Query  954   ERNPLLCRGGT-CVNTEGSFQCDCPLGHEL------SPSREECIDVNECSLSDSLCRNGK  1006
                   C   T C+N  GS+QC C  G +        P+   C DV+ECS     C +  
Sbjct  168   TSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSST  227

Query  1007  -CVNMVGTYQCSCNSGYQ  1023
              C N VG+Y C C  G++
Sbjct  228   VCFNTVGSYSCRCRPGWK  245


 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 80/160 (50%), Gaps = 22/160 (14%)

Query  301  CIPTLSSYRCECNMGY---------KQDSNGDCTDVDECTSNP---CSNGDCVNTPGSYY  348
            C  T  SY C C+ GY         K +S   C DVDEC  NP    S G CVNT GSY 
Sbjct  85   CWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYT  144

Query  349  CKCHAGFQRTPTK-QACIDIDECIQNGVLCKNG-RCVNTDGSFQCICNAGFELTTDGKN-  405
            C+C  GF+  P   + C D++EC      C +   C+N  GS+QC C  G++      N 
Sbjct  145  CQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNG  204

Query  406  -----CVDHDECTT-TNMC-LNGMCINEDGSFKCICKPGF  438
                 C D DEC++  + C  + +C N  GS+ C C+PG+
Sbjct  205  PNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGW  244


 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 67/130 (52%), Gaps = 15/130 (12%)

Query  559  DINECALDPDICSNGI--CENLRGSYRCNCNSGYEP--------DPSGRNCVDIDECSVN  608
            DINECA    +       C N  GSY C C+ GYEP        + S   C D+DEC  N
Sbjct  67   DINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQN  126

Query  609  RLLCDN-GLCRNTPGSYSCTCPKGYVFSTE-TDTCEDINECES--SPCVNGA-CRNNLGS  663
              LC + G C NT GSY+C C  G+    E    C D+NEC S  +PC +   C NN+GS
Sbjct  127  PRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGS  186

Query  664  FNCECSPGSK  673
            + C C PG +
Sbjct  187  YQCRCRPGWQ  196


 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 85/163 (52%), Gaps = 25/163 (15%)

Query  337  NGDCVNTPGSYYCKCHAGFQR-----TPTKQACIDIDECIQ-NGVLC-KNGRCVNTDGSF  389
            +  CVN      C+C+ GF       T   + C DI+EC   + V C K   C NT+GS+
Sbjct  36   DSSCVNATA---CRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSY  92

Query  390  QCICNAGFELTTDGKN--------CVDHDECTTT-NMCLN-GMCINEDGSFKCICKPGFV  439
             C+C+ G+E  +  K         C D DEC     +C + G C+N  GS+ C C PGF 
Sbjct  93   DCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFK  152

Query  440  LAP-NGRYCTDIDECQTSGI---CMNGHCINTEGSFRCECPPG  478
            L P + + CTD++EC TSG      + HC+N  GS++C C PG
Sbjct  153  LKPEDPKLCTDVNEC-TSGQNPCHSSTHCLNNVGSYQCRCRPG  194


 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 89/181 (49%), Gaps = 23/181 (13%)

Query  1197  CIDLDECSNGTH-QCSVNAQCVNSPGSYLCACVEGFT----GDGF------TCSDVDECA  1245
             C D++EC+  +   C   + C N+ GSY C C  G+        F      TC DVDEC 
Sbjct  65    CDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQ  124

Query  1246  ENVHLCEN-GQCLNVPGAYRCECEMGF-TPASDSKSCQDINEC-SFQNICVFGT-CNNLP  1301
             +N  LC++ G C+N  G+Y C+C  GF     D K C D+NEC S QN C   T C N  
Sbjct  125   QNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNV  184

Query  1302  GMFHCICDDGYELDRTGGN------CTDVDECADPINC--VNGLCVNTPGRYECNCPPDF  1353
             G + C C  G++      N      C DVDEC+   +    + +C NT G Y C C P +
Sbjct  185   GSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGW  244

Query  1354  Q  1354
             +
Sbjct  245   K  245


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 88/187 (47%), Gaps = 21/187 (11%)

Query  987   EECIDVNECS-LSDSLC-RNGKCVNMVGTYQCSCNSGYQATPDRRS--------CTDIDE  1036
             E C D+NEC+ LS   C +   C N  G+Y C C+ GY+     ++        C D+DE
Sbjct  63    ETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDE  122

Query  1037  CMIMNGGCHTH--CTNSEGSYECSCSDGYALMP-DVRTCADIDECESNPDICDGG-QCTN  1092
             C      C ++  C N+ GSY C C  G+ L P D + C D++EC S  + C     C N
Sbjct  123   CQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLN  182

Query  1093  IPGEYRCLCYDGFMA------SMDMKTCIDVNECDLNSNICMFGE-CENTKGSFICHCQL  1145
               G Y+C C  G+          +   C DV+EC    + C     C NT GS+ C C+ 
Sbjct  183   NVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRP  242

Query  1146  GYSVKKG  1152
             G+  + G
Sbjct  243   GWKPRHG  249


 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 69/128 (54%), Gaps = 13/128 (10%)

Query  284  QTIDICKHHPDLCLN-GRCIPTLSSYRCECNMGYKQDSNGD--CTDVDECTS--NPC-SN  337
            Q +D C+ +P LC + G C+ TL SY C+C  G+K        CTDV+ECTS  NPC S+
Sbjct  118  QDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSS  177

Query  338  GDCVNTPGSYYCKCHAGFQRTP------TKQACIDIDECIQNGVLCKNGR-CVNTDGSFQ  390
              C+N  GSY C+C  G+Q  P          C D+DEC      C +   C NT GS+ 
Sbjct  178  THCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYS  237

Query  391  CICNAGFE  398
            C C  G++
Sbjct  238  CRCRPGWK  245


 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 123/299 (41%), Gaps = 62/299 (21%)

Query  1708  CICHNGFKASQD-----QTMCMDVDEC---ERHPCGNGT-CKNTVGSYNCLCYPGFELTH  1758
             C C+ GF +  +        C D++EC    +  CG  + C NT GSY+C+C PG+E   
Sbjct  45    CRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVS  104

Query  1759  ---------NNDCMDIDECSSFFGQVCRN-GRCFNEIGSFKCLCNEGYELT-LDGKNCID  1807
                       N C D+DEC     ++C++ G C N +GS+ C C  G++L   D K C D
Sbjct  105   GAKTFKNESENTCQDVDECQQN-PRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTD  163

Query  1808  TNECVALPGSCSPGT-CQNLEGSFRCICPPGYEVKSES--------CIDINECNEDPNIC  1858
              NEC +    C   T C N  GS++C C PG++    S        C D++EC+   + C
Sbjct  164   VNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQC  223

Query  1859  LFGS-CTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKC  1917
                + C NT G + C C  G+                        +  +P      +   
Sbjct  224   DSSTVCFNTVGSYSCRCRPGW----------------------KPRHGIPN----NQKDT  257

Query  1918  CCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPG-----IDDTREDVNECLESPG  1971
              C  M    W  P  +  +     F  +   G    PG     I    + ++E LE+PG
Sbjct  258   VCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDYKPGLANNTIQSILQALDELLEAPG  316


 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 70/243 (29%), Positives = 104/243 (43%), Gaps = 53/243 (22%)

Query  1453  QGGNCINTFGSFQCECPKGY-----YLSEETRICEDIDECVAHPGV-CGPGT-CYNTLGN  1505
             Q  +C+N      C C  G+      ++     C+DI+EC     V CG  + C+NT G+
Sbjct  35    QDSSCVNATA---CRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGS  91

Query  1506  YTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMC----CCTYNVGK  1561
             Y C+C P Y  V+G        K+F   S N  +C++        R+C     C   +G 
Sbjct  92    YDCVCSPGYEPVSGA-------KTFKNESEN--TCQDVDECQQNPRLCKSYGTCVNTLGS  142

Query  1562  AWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKA-VDIDECKEIPGICANGV-CINQI  1619
                                 C  +PGF       K   D++EC      C +   C+N +
Sbjct  143   Y------------------TCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNV  184

Query  1620  GSFRCECPTGFS--------YNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAA  1671
             GS++C C  G+          N+   VCED+DECS+G + C  +  C N+ GSY C C  
Sbjct  185   GSYQCRCRPGWQPIPGSPNGPNN--TVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRP  242

Query  1672  GFK  1674
             G+K
Sbjct  243   GWK  245


 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 64/128 (50%), Gaps = 12/128 (9%)

Query  558  RDINECALDPDIC-SNGICENLRGSYRCNCNSGYEPDPSG-RNCVDIDECSVNRLLCDNG  615
            +D++EC  +P +C S G C N  GSY C C  G++  P   + C D++EC+  +  C + 
Sbjct  118  QDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSS  177

Query  616  L-CRNTPGSYSCTCPKGYV------FSTETDTCEDINECESSPC---VNGACRNNLGSFN  665
              C N  GSY C C  G+              CED++EC S       +  C N +GS++
Sbjct  178  THCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYS  237

Query  666  CECSPGSK  673
            C C PG K
Sbjct  238  CRCRPGWK  245


 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 80/251 (32%), Positives = 106/251 (42%), Gaps = 42/251 (17%)

Query  423  CINEDGSFKCICKPGF-----VLAPNGRYCTDIDECQTSGICMNGH---CINTEGSFRCE  474
            C+N      C C PGF     ++      C DI+EC T      G    C NTEGS+ C 
Sbjct  39   CVNATA---CRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCV  95

Query  475  CPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHP  534
            C PG    V G         +TC    +     R     + KS   C N    +   C P
Sbjct  96   CSPGYE-PVSGAKTFKNESENTCQDVDECQQNPR-----LCKSYGTCVNTLGSYTCQCLP  149

Query  535  CPAKNSAEFHGLCSSGIGITVDGRDINECALDPDIC-SNGICENLRGSYRCNCNSGYEPD  593
               K   E   LC+          D+NEC    + C S+  C N  GSY+C C  G++P 
Sbjct  150  G-FKLKPEDPKLCT----------DVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPI  198

Query  594  PSGRN------CVDIDECSVNRLLCDNG-LCRNTPGSYSCTCPKGY-----VFSTETDT-  640
            P   N      C D+DECS  +  CD+  +C NT GSYSC C  G+     + + + DT 
Sbjct  199  PGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTV  258

Query  641  CEDINECESSP  651
            CED+     +P
Sbjct  259  CEDMTFSTWTP  269


 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 48/79 (61%), Gaps = 3/79 (4%)

Query  65   CQDVDECQAIPGVCQG-GNCINTVGSYECKCPAGHK-QNEATQKCDDIDECSIIPGICEG  122
            CQDVDECQ  P +C+  G C+NT+GSY C+C  G K + E  + C D++EC+     C  
Sbjct  117  CQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHS  176

Query  123  S-ECSNTVGSYFCICPRGY  140
            S  C N VGSY C C  G+
Sbjct  177  STHCLNNVGSYQCRCRPGW  195


 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 66/127 (52%), Gaps = 19/127 (15%)

Query  1785  IGSFKCLCNEGYE-----LTLDGKNCIDTNECVALPG-SCSPGT-CQNLEGSFRCICPPG  1837
             + +  C CN G+      +T   + C D NEC  L   SC   + C N EGS+ C+C PG
Sbjct  40    VNATACRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPG  99

Query  1838  YE-------VKSES---CIDINECNEDPNICL-FGSCTNTPGGFQCICPTGFVLS-DNGR  1885
             YE        K+ES   C D++EC ++P +C  +G+C NT G + C C  GF L  ++ +
Sbjct  100   YEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPK  159

Query  1886  RCFDTRQ  1892
              C D  +
Sbjct  160   LCTDVNE  166


 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 55/86 (64%), Gaps = 4/86 (5%)

Query  1957  DDTREDVNECLESPGVC-SNGHCINTDGSFRCECPMGYNLDYTGVH-CIDTDECSIG-NP  2013
             ++T +DV+EC ++P +C S G C+NT GS+ C+C  G+ L       C D +EC+ G NP
Sbjct  114   ENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNP  173

Query  2014  CGNGT-CTNVIGSFECNCHEGFEPGP  2038
             C + T C N +GS++C C  G++P P
Sbjct  174   CHSSTHCLNNVGSYQCRCRPGWQPIP  199


 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 84/282 (30%), Positives = 112/282 (40%), Gaps = 62/282 (22%)

Query  1252  ENGQCLNVPGAYRCECEMGFTPASD-----SKSCQDINECSFQNICV---FGTCNNLPGM  1303
             ++  C+N   A  C C  GF+  S+      ++C DINEC+  +      F  C N  G 
Sbjct  35    QDSSCVN---ATACRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGS  91

Query  1304  FHCICDDGYE--------LDRTGGNCTDVDECA-DPINCVN-GLCVNTPGRYECNCPPDF  1353
             + C+C  GYE         + +   C DVDEC  +P  C + G CVNT G Y C C P F
Sbjct  92    YDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGF  151

Query  1354  QLNPTGVG-CVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETC  1412
             +L P     C D  V  C     P    S  C   +G       C C  G  W       
Sbjct  152   KLKPEDPKLCTD--VNECTSGQNP-CHSSTHCLNNVG----SYQCRCRPG--WQ------  196

Query  1413  PPVNSTEYNTLCPGGEGFRPN-PITIILEDIDECQELPGLCQGGN-CINTFGSFQCECPK  1470
              P+         PG     PN P   + ED+DEC      C     C NT GS+ C C  
Sbjct  197   -PI---------PGS----PNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRP  242

Query  1471  GYYL------SEETRICEDIDECVAHPGVCGPGTCYNTLGNY  1506
             G+        +++  +CED+      P    PG    TL  +
Sbjct  243   GWKPRHGIPNNQKDTVCEDMTFSTWTP---PPGVHSQTLSRF  281


 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 57/110 (52%), Gaps = 18/110 (16%)

Query  584  CNCNSGYEP-----DPSGRNCVDIDECS-VNRLLCDN-GLCRNTPGSYSCTCPKGY----  632
            C CN G+             C DI+EC+ ++++ C     C NT GSY C C  GY    
Sbjct  45   CRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVS  104

Query  633  ---VFSTETD-TCEDINECESSPCV---NGACRNNLGSFNCECSPGSKLD  675
                F  E++ TC+D++EC+ +P +    G C N LGS+ C+C PG KL 
Sbjct  105  GAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLK  154


> sp|P48960|CD97_HUMAN CD97 antigen OS=Homo sapiens GN=CD97 PE=1 
SV=4
Length=835

 Score = 116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 101/213 (47%), Gaps = 28/213 (13%)

Query  1003  RNGKCVNMVGTYQCSCNSGYQA-----TPDRRSCTDIDECMIMNG---GCHTHCTNSEGS  1054
             +N  CVN      C CN G+ +     T    +C DI+EC   +    G  + C N+EGS
Sbjct  32    QNSSCVNATA---CRCNPGFSSFSEIITTPTETCDDINECATPSKVSCGKFSDCWNTEGS  88

Query  1055  YECSCSDGYALMPDVRT--------CADIDECESNPDICDG-GQCTNIPGEYRCLCYDGF  1105
             Y+C CS GY  +   +T        C D+DEC+ NP +C   G C N  G Y C C  GF
Sbjct  89    YDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGF  148

Query  1106  -MASMDMKTCIDVNECDLNSNICMFG-ECENTKGSFICHCQLGYSVKKGT------TGCT  1157
                  D K C DVNEC    N C     C N  GS+ C C+ G+    G+      T C 
Sbjct  149   KFIPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCE  208

Query  1158  DVDECEIGAHNCDMHASCVNVPGSFKCSCREGW  1190
             DVDEC  G H CD    C N  GS+ C CR GW
Sbjct  209   DVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGW  241


 Score = 103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 113/213 (53%), Gaps = 30/213 (14%)

Query  1612  NGVCINQIGSFRCECPTGFS-YNDLLLV----CEDIDECSNGDNL-CQRNADCINSPGSY  1665
             N  C+N      C C  GFS +++++      C+DI+EC+    + C + +DC N+ GSY
Sbjct  33    NSSCVNATA---CRCNPGFSSFSEIITTPTETCDDINECATPSKVSCGKFSDCWNTEGSY  89

Query  1666  RCECAAG---------FKLSPNGACVDRNECLEIPNVC-SHGLCVDMQGSYKCICHNGFK  1715
              C C+ G         FK      C D +EC + P +C S+G CV+  GSY C C  GFK
Sbjct  90    DCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFK  149

Query  1716  -ASQDQTMCMDVDECE--RHPCGNGT-CKNTVGSYNCLCYPGFELT-------HNNDCMD  1764
                +D  +C DV+EC   ++PC + T C N VGSY C C PG++         +N  C D
Sbjct  150   FIPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCED  209

Query  1765  IDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYE  1797
             +DECSS   Q   +  CFN +GS+ C C  G++
Sbjct  210   VDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWK  242


 Score = 100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 98/200 (49%), Gaps = 25/200 (13%)

Query  1057  CSCSDGYALMPDV-----RTCADIDECESNPDICDG--GQCTNIPGEYRCLCYDGFMASM  1109
             C C+ G++   ++      TC DI+EC +   +  G    C N  G Y C+C  G+    
Sbjct  42    CRCNPGFSSFSEIITTPTETCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVS  101

Query  1110  DMKT--------CIDVNECDLNSNICM-FGECENTKGSFICHCQLGYS-VKKGTTGCTDV  1159
               KT        C DV+EC  N  +C  +G C NT GS+ C C  G+  + +    CTDV
Sbjct  102   GAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDV  161

Query  1160  DECEIGAHNCDMHASCVNVPGSFKCSCREGWVG--------NGIKCIDLDECSNGTHQCS  1211
             +EC  G + C     C+N  GS++C CR GW          N   C D+DECS+G HQC 
Sbjct  162   NECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCD  221

Query  1212  VNAQCVNSPGSYLCACVEGF  1231
              +  C N+ GSY C C  G+
Sbjct  222   SSTVCFNTVGSYSCRCRPGW  241


 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 95/354 (27%), Positives = 138/354 (39%), Gaps = 48/354 (14%)

Query  1067  PDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNI  1126
             P   +C +   C  NP      +    P E                TC D+NEC   S +
Sbjct  31    PQNSSCVNATACRCNPGFSSFSEIITTPTE----------------TCDDINECATPSKV  74

Query  1127  C--MFGECENTKGSFICHCQLGYSVKKGTTG--------CTDVDECEIGAHNCDMHASCV  1176
                 F +C NT+GS+ C C  GY    G           C DVDEC+     C  + +CV
Sbjct  75    SCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCV  134

Query  1177  NVPGSFKCSCREGWV---GNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTG  1233
             N  GS+ C C  G+     +   C D++EC++G + C  +  C+N+ GSY C C  G+  
Sbjct  135   NTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQP  194

Query  1234  --------DGFTCSDVDECAENVHLCENGQ-CLNVPGAYRCECEMGFTPASDSKSCQDIN  1284
                     +   C DVDEC+   H C++   C N  G+Y C C  G+ P     + Q   
Sbjct  195   IPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDT  254

Query  1285  ECSFQNICVFGTCNNLPGM----FHCICDDGYELDRTGGNCTDVDECADPINCVNGLCVN  1340
              C       F T    PG+         D   +L R     +      + I  V+ L + 
Sbjct  255   VCEDMT---FSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQNVIKLVDEL-ME  310

Query  1341  TPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSL--SCNTEIGVGV  1392
              PG  E   PP   L  T +      +     K  P+G  +     NTE+ + +
Sbjct  311   APGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMI  364


 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 103/200 (52%), Gaps = 32/200 (16%)

Query  310  CECNMGYKQDS------NGDCTDVDEC-TSNPCSNG---DCVNTPGSYYCKCHAGFQ---  356
            C CN G+   S         C D++EC T +  S G   DC NT GSY C C  G++   
Sbjct  42   CRCNPGFSSFSEIITTPTETCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVS  101

Query  357  -----RTPTKQACIDIDECIQNGVLCKN-GRCVNTDGSFQCICNAGFELT-TDGKNCVDH  409
                 +  ++  C D+DEC QN  LCK+ G CVNT GS+ C C  GF+    D K C D 
Sbjct  102  GAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDV  161

Query  410  DECTT-TNMCLNGM-CINEDGSFKCICKPGFVL------APNGRYCTDIDECQTSGICM-  460
            +ECT+  N C +   C+N  GS++C C+PG+         PN   C D+DEC +SG    
Sbjct  162  NECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDEC-SSGQHQC  220

Query  461  --NGHCINTEGSFRCECPPG  478
              +  C NT GS+ C C PG
Sbjct  221  DSSTVCFNTVGSYSCRCRPG  240


 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 84/164 (51%), Gaps = 20/164 (12%)

Query  1615  CINQIGSFRCECPTGFS--------YNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYR  1666
             C N  GS+ C C  G+          N+    C+D+DEC     LC+    C+N+ GSY 
Sbjct  82    CWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYT  141

Query  1667  CECAAGFKLSPN--GACVDRNECLEIPNVC-SHGLCVDMQGSYKCICHNGFKA------S  1717
             C+C  GFK  P     C D NEC    N C S   C++  GSY+C C  G++        
Sbjct  142   CQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNG  201

Query  1718  QDQTMCMDVDECE--RHPCGNGT-CKNTVGSYNCLCYPGFELTH  1758
              + T+C DVDEC   +H C + T C NTVGSY+C C PG++  H
Sbjct  202   PNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRH  245


 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 99/198 (50%), Gaps = 22/198 (11%)

Query  847   PGFSNRGDILTGRPFY-KDINECKVFPGMCMNGK---CRNTIGSFKCKCNSGF-------  895
             PGFS+  +I+T       DINEC   P     GK   C NT GS+ C C+ G+       
Sbjct  46    PGFSSFSEIITTPTETCDDINECAT-PSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAK  104

Query  896   TLDMEERN-CTDIDECWISPDLCGS-GTCVNTPGSFECECFDGYESGFMMMKNCMDIDEC  953
             T   E  N C D+DEC  +P LC S GTCVNT GS+ C+C  G++      K C D++EC
Sbjct  105   TFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNEC  164

Query  954   ERNPLLCRGGT-CVNTEGSFQCDCPLGHEL------SPSREECIDVNECSLSDSLCRNGK  1006
                   C   T C+N  GS+QC C  G +        P+   C DV+ECS     C +  
Sbjct  165   TSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSST  224

Query  1007  -CVNMVGTYQCSCNSGYQ  1023
              C N VG+Y C C  G++
Sbjct  225   VCFNTVGSYSCRCRPGWK  242


 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 82/144 (57%), Gaps = 16/144 (11%)

Query  1599  DIDECKEIPGICAN-GVCINQIGSFRCECPTGFSY-NDLLLVCEDIDECSNGDNLCQRNA  1656
             D+DEC++ P +C + G C+N +GS+ C+C  GF +  +   VC D++EC++G N C  + 
Sbjct  116   DVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSST  175

Query  1657  DCINSPGSYRCECAAGFKL---SPNG----ACVDRNECLEIPNVC-SHGLCVDMQGSYKC  1708
              C+N+ GSY+C C  G++    SPNG     C D +EC    + C S  +C +  GSY C
Sbjct  176   HCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSC  235

Query  1709  ICHNGFKA------SQDQTMCMDV  1726
              C  G+K       +Q  T+C D+
Sbjct  236   RCRPGWKPRHGIPNNQKDTVCEDM  259


 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 80/160 (50%), Gaps = 22/160 (14%)

Query  301  CIPTLSSYRCECNMGY---------KQDSNGDCTDVDECTSNP---CSNGDCVNTPGSYY  348
            C  T  SY C C+ GY         K +S   C DVDEC  NP    S G CVNT GSY 
Sbjct  82   CWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYT  141

Query  349  CKCHAGFQRTPTK-QACIDIDECIQNGVLCKNG-RCVNTDGSFQCICNAGFELTTDGKN-  405
            C+C  GF+  P   + C D++EC      C +   C+N  GS+QC C  G++      N 
Sbjct  142  CQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNG  201

Query  406  -----CVDHDECTT-TNMC-LNGMCINEDGSFKCICKPGF  438
                 C D DEC++  + C  + +C N  GS+ C C+PG+
Sbjct  202  PNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGW  241


 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 86/164 (52%), Gaps = 27/164 (16%)

Query  337  NGDCVNTPGSYYCKCHAGFQR------TPTKQACIDIDECIQ-NGVLC-KNGRCVNTDGS  388
            N  CVN      C+C+ GF        TPT + C DI+EC   + V C K   C NT+GS
Sbjct  33   NSSCVNATA---CRCNPGFSSFSEIITTPT-ETCDDINECATPSKVSCGKFSDCWNTEGS  88

Query  389  FQCICNAGFELTTDGKN--------CVDHDECTTT-NMCLN-GMCINEDGSFKCICKPGF  438
            + C+C+ G+E  +  K         C D DEC     +C + G C+N  GS+ C C PGF
Sbjct  89   YDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGF  148

Query  439  VLAP-NGRYCTDIDECQTSGI---CMNGHCINTEGSFRCECPPG  478
               P + + CTD++EC TSG      + HC+N  GS++C C PG
Sbjct  149  KFIPEDPKVCTDVNEC-TSGQNPCHSSTHCLNNVGSYQCRCRPG  191


 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 86/187 (46%), Gaps = 21/187 (11%)

Query  987   EECIDVNECSLSDSLC--RNGKCVNMVGTYQCSCNSGYQATPDRRS--------CTDIDE  1036
             E C D+NEC+    +   +   C N  G+Y C C+ GY+     ++        C D+DE
Sbjct  60    ETCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDE  119

Query  1037  CMIMNGGCHTH--CTNSEGSYECSCSDGYALMP-DVRTCADIDECESNPDICDGG-QCTN  1092
             C      C ++  C N+ GSY C C  G+  +P D + C D++EC S  + C     C N
Sbjct  120   CQQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLN  179

Query  1093  IPGEYRCLCYDGFMA------SMDMKTCIDVNECDLNSNICMFGE-CENTKGSFICHCQL  1145
               G Y+C C  G+          +   C DV+EC    + C     C NT GS+ C C+ 
Sbjct  180   NVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRP  239

Query  1146  GYSVKKG  1152
             G+  + G
Sbjct  240   GWKPRHG  246


 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 72/243 (30%), Positives = 106/243 (44%), Gaps = 53/243 (22%)

Query  1453  QGGNCINTFGSFQCECPKGY-----YLSEETRICEDIDECVAHPGV-CGPGT-CYNTLGN  1505
             Q  +C+N      C C  G+      ++  T  C+DI+EC     V CG  + C+NT G+
Sbjct  32    QNSSCVNATA---CRCNPGFSSFSEIITTPTETCDDINECATPSKVSCGKFSDCWNTEGS  88

Query  1506  YTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMC----CCTYNVGK  1561
             Y C+C P Y  V+G        K+F   S N  +C++        R+C     C   +G 
Sbjct  89    YDCVCSPGYEPVSGA-------KTFKNESEN--TCQDVDECQQNPRLCKSYGTCVNTLGS  139

Query  1562  AWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKA-VDIDECKEIPGICANGV-CINQI  1619
                                 C  +PGF F     K   D++EC      C +   C+N +
Sbjct  140   Y------------------TCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNNV  181

Query  1620  GSFRCECPTGFS--------YNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAA  1671
             GS++C C  G+          N+   VCED+DECS+G + C  +  C N+ GSY C C  
Sbjct  182   GSYQCRCRPGWQPIPGSPNGPNN--TVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRP  239

Query  1672  GFK  1674
             G+K
Sbjct  240   GWK  242


 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 80/171 (47%), Gaps = 27/171 (16%)

Query  1210  CSVNAQCVNSPGSYLCACVEGF-------TGDGFTCSDVDECA--ENVHLCENGQCLNVP  1260
             C  N+ CVN+     C C  GF       T    TC D++ECA    V   +   C N  
Sbjct  30    CPQNSSCVNATA---CRCNPGFSSFSEIITTPTETCDDINECATPSKVSCGKFSDCWNTE  86

Query  1261  GAYRCECEMGFTPASDSK--------SCQDINECSFQNICV---FGTCNNLPGMFHCICD  1309
             G+Y C C  G+ P S +K        +CQD++EC  QN  +   +GTC N  G + C C 
Sbjct  87    GSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQ-QNPRLCKSYGTCVNTLGSYTCQCL  145

Query  1310  DGYE-LDRTGGNCTDVDECADPIN--CVNGLCVNTPGRYECNCPPDFQLNP  1357
              G++ +      CTDV+EC    N    +  C+N  G Y+C C P +Q  P
Sbjct  146   PGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIP  196


 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 100/245 (41%), Gaps = 63/245 (26%)

Query  378  KNGRCVNTDGSFQCICNAGFE-----LTTDGKNCVDHDECTTTNMCLNGM---CINEDGS  429
            +N  CVN      C CN GF      +TT  + C D +EC T +    G    C N +GS
Sbjct  32   QNSSCVNATA---CRCNPGFSSFSEIITTPTETCDDINECATPSKVSCGKFSDCWNTEGS  88

Query  430  FKCICKPGFVLAPNGRY--------CTDIDECQTS-GICMN-GHCINTEGSFRCECPPGL  479
            + C+C PG+      +         C D+DECQ +  +C + G C+NT GS+ C+C PG 
Sbjct  89   YDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGF  148

Query  480  A-VGVDGRVCVDT----------HMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGF  528
              +  D +VC D           H  + C   +    C R  PG                
Sbjct  149  KFIPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQC-RCRPG----------------  191

Query  529  GEPCHPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDIC-SNGICENLRGSYRCNCN  587
                 P P   +   + +C           D++EC+     C S+ +C N  GSY C C 
Sbjct  192  ---WQPIPGSPNGPNNTVC----------EDVDECSSGQHQCDSSTVCFNTVGSYSCRCR  238

Query  588  SGYEP  592
             G++P
Sbjct  239  PGWKP  243


 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 64/128 (50%), Gaps = 12/128 (9%)

Query  558  RDINECALDPDIC-SNGICENLRGSYRCNCNSGYEPDPSG-RNCVDIDECSVNRLLCDNG  615
            +D++EC  +P +C S G C N  GSY C C  G++  P   + C D++EC+  +  C + 
Sbjct  115  QDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSS  174

Query  616  L-CRNTPGSYSCTCPKGYV------FSTETDTCEDINECESSPC---VNGACRNNLGSFN  665
              C N  GSY C C  G+              CED++EC S       +  C N +GS++
Sbjct  175  THCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYS  234

Query  666  CECSPGSK  673
            C C PG K
Sbjct  235  CRCRPGWK  242


 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 107/254 (42%), Gaps = 42/254 (17%)

Query  420  NGMCINEDGSFKCICKPGF-----VLAPNGRYCTDIDECQTSGICMNGH---CINTEGSF  471
            N  C+N      C C PGF     ++      C DI+EC T      G    C NTEGS+
Sbjct  33   NSSCVNATA---CRCNPGFSSFSEIITTPTETCDDINECATPSKVSCGKFSDCWNTEGSY  89

Query  472  RCECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEP  531
             C C PG    V G         +TC    +     R     + KS   C N    +   
Sbjct  90   DCVCSPGYE-PVSGAKTFKNESENTCQDVDECQQNPR-----LCKSYGTCVNTLGSYTCQ  143

Query  532  CHPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDIC-SNGICENLRGSYRCNCNSGY  590
            C P   K   E   +C+          D+NEC    + C S+  C N  GSY+C C  G+
Sbjct  144  CLPG-FKFIPEDPKVCT----------DVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGW  192

Query  591  EPDPSGRN------CVDIDECSVNRLLCDNG-LCRNTPGSYSCTCPKGY-----VFSTET  638
            +P P   N      C D+DECS  +  CD+  +C NT GSYSC C  G+     + + + 
Sbjct  193  QPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQK  252

Query  639  DT-CEDINECESSP  651
            DT CED+     +P
Sbjct  253  DTVCEDMTFSTWTP  266


 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 61/121 (50%), Gaps = 23/121 (19%)

Query  1777  RNGRCFNEIGSFKCLCNEGYE-----LTLDGKNCIDTNECVALPGSCSPGT---CQNLEG  1828
             +N  C N      C CN G+      +T   + C D NEC A P   S G    C N EG
Sbjct  32    QNSSCVNATA---CRCNPGFSSFSEIITTPTETCDDINEC-ATPSKVSCGKFSDCWNTEG  87

Query  1829  SFRCICPPGYE-------VKSES---CIDINECNEDPNICL-FGSCTNTPGGFQCICPTG  1877
             S+ C+C PGYE        K+ES   C D++EC ++P +C  +G+C NT G + C C  G
Sbjct  88    SYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPG  147

Query  1878  F  1878
             F
Sbjct  148   F  148


 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 47/79 (59%), Gaps = 3/79 (4%)

Query  65   CQDVDECQAIPGVCQG-GNCINTVGSYECKCPAGHK-QNEATQKCDDIDECSIIPGICEG  122
            CQDVDECQ  P +C+  G C+NT+GSY C+C  G K   E  + C D++EC+     C  
Sbjct  114  CQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHS  173

Query  123  S-ECSNTVGSYFCICPRGY  140
            S  C N VGSY C C  G+
Sbjct  174  STHCLNNVGSYQCRCRPGW  192


 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 55/86 (64%), Gaps = 4/86 (5%)

Query  1957  DDTREDVNECLESPGVC-SNGHCINTDGSFRCECPMGYN-LDYTGVHCIDTDECSIG-NP  2013
             ++T +DV+EC ++P +C S G C+NT GS+ C+C  G+  +      C D +EC+ G NP
Sbjct  111   ENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNP  170

Query  2014  CGNGT-CTNVIGSFECNCHEGFEPGP  2038
             C + T C N +GS++C C  G++P P
Sbjct  171   CHSSTHCLNNVGSYQCRCRPGWQPIP  196


 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 55/109 (50%), Gaps = 18/109 (17%)

Query  584  CNCNSGYEP-----DPSGRNCVDIDECSV-NRLLCDN-GLCRNTPGSYSCTCPKGY----  632
            C CN G+             C DI+EC+  +++ C     C NT GSY C C  GY    
Sbjct  42   CRCNPGFSSFSEIITTPTETCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVS  101

Query  633  ---VFSTETD-TCEDINECESSPCV---NGACRNNLGSFNCECSPGSKL  674
                F  E++ TC+D++EC+ +P +    G C N LGS+ C+C PG K 
Sbjct  102  GAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKF  150


> sp|O95460|MATN4_HUMAN Matrilin-4 OS=Homo sapiens GN=MATN4 PE=1 
SV=3
Length=622

 Score = 104 bits (260),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 61/171 (36%), Positives = 84/171 (49%), Gaps = 5/171 (3%)

Query  1201  DECSNGTHQCSVNAQCVNSPGSYLCACVEGF--TGDGFTCSDVDECAENVHLCENGQCLN  1258
             D+C+ G H C    QCVN+   + C C  G+    D  +C  +D CAE  H CE+  C+N
Sbjct  217   DQCAEGGHGC--QHQCVNAWAMFHCTCNPGYKLAADNKSCLAIDLCAEGTHGCEH-HCVN  273

Query  1259  VPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYELDRTG  1318
              PG+Y C C++GF    D +SC+ I+ CSF N      C + PG   C C +G++L   G
Sbjct  274   SPGSYFCHCQVGFVLQQDQRSCRAIDYCSFGNHSCQHECVSTPGGPRCHCREGHDLQPDG  333

Query  1319  GNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGN  1369
              +C   D C    +     CV+    Y C CP   QL   G  C   R G+
Sbjct  334   RSCQVRDLCNGVDHGCEFQCVSEGLSYRCLCPEGRQLQADGKSCNRCREGH  384


 Score = 95.5 bits (236),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 60/185 (32%), Positives = 87/185 (47%), Gaps = 11/185 (6%)

Query  1063  YALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDL  1122
             + L    R C   D+C      C   QC N    + C C  G+  + D K+C+ ++ C  
Sbjct  205   FGLQFQSRLCGK-DQCAEGGHGCQH-QCVNAWAMFHCTCNPGYKLAADNKSCLAIDLCAE  262

Query  1123  NSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSF  1182
              ++ C    C N+ GS+ CHCQ+G+ +++    C  +D C  G H+C     CV+ PG  
Sbjct  263   GTHGCEH-HCVNSPGSYFCHCQVGFVLQQDQRSCRAIDYCSFGNHSC--QHECVSTPGGP  319

Query  1183  KCSCREG--WVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEG--FTGDGFTC  1238
             +C CREG     +G  C   D C+   H C    QCV+   SY C C EG     DG +C
Sbjct  320   RCHCREGHDLQPDGRSCQVRDLCNGVDHGCEF--QCVSEGLSYRCLCPEGRQLQADGKSC  377

Query  1239  SDVDE  1243
             +   E
Sbjct  378   NRCRE  382


 Score = 95.1 bits (235),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 55/169 (33%), Positives = 80/169 (47%), Gaps = 3/169 (2%)

Query  993   NECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSE  1052
             ++C+     C++ +CVN    + C+CN GY+   D +SC  ID C     GC  HC NS 
Sbjct  217   DQCAEGGHGCQH-QCVNAWAMFHCTCNPGYKLAADNKSCLAIDLCAEGTHGCEHHCVNSP  275

Query  1053  GSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMK  1112
             GSY C C  G+ L  D R+C  ID C      C   +C + PG  RC C +G     D +
Sbjct  276   GSYFCHCQVGFVLQQDQRSCRAIDYCSFGNHSCQ-HECVSTPGGPRCHCREGHDLQPDGR  334

Query  1113  TCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDE  1161
             +C   + C+   + C F +C +   S+ C C  G  ++     C    E
Sbjct  335   SCQVRDLCNGVDHGCEF-QCVSEGLSYRCLCPEGRQLQADGKSCNRCRE  382


 Score = 92.0 bits (227),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 51/156 (33%), Positives = 80/156 (51%), Gaps = 5/156 (3%)

Query  300  RCIPTLSSYRCECNMGYKQDS-NGDCTDVDECT--SNPCSNGDCVNTPGSYYCKCHAGFQ  356
            +C+   + + C CN GYK  + N  C  +D C   ++ C +  CVN+PGSY+C C  GF 
Sbjct  229  QCVNAWAMFHCTCNPGYKLAADNKSCLAIDLCAEGTHGCEH-HCVNSPGSYFCHCQVGFV  287

Query  357  RTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTN  416
                +++C  ID C      C++  CV+T G  +C C  G +L  DG++C   D C   +
Sbjct  288  LQQDQRSCRAIDYCSFGNHSCQH-ECVSTPGGPRCHCREGHDLQPDGRSCQVRDLCNGVD  346

Query  417  MCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDIDE  452
                  C++E  S++C+C  G  L  +G+ C    E
Sbjct  347  HGCEFQCVSEGLSYRCLCPEGRQLQADGKSCNRCRE  382


 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 58/178 (33%), Positives = 82/178 (46%), Gaps = 5/178 (3%)

Query  895   FTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECE  954
             F L  + R C   D+C      C    CVN    F C C  GY+      K+C+ ID C 
Sbjct  205   FGLQFQSRLCGK-DQCAEGGHGC-QHQCVNAWAMFHCTCNPGYKLA-ADNKSCLAIDLCA  261

Query  955   RNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTY  1014
                  C    CVN+ GS+ C C +G  L   +  C  ++ CS  +  C++ +CV+  G  
Sbjct  262   EGTHGCEH-HCVNSPGSYFCHCQVGFVLQQDQRSCRAIDYCSFGNHSCQH-ECVSTPGGP  319

Query  1015  QCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTC  1072
             +C C  G+   PD RSC   D C  ++ GC   C +   SY C C +G  L  D ++C
Sbjct  320   RCHCREGHDLQPDGRSCQVRDLCNGVDHGCEFQCVSEGLSYRCLCPEGRQLQADGKSC  377


 Score = 87.4 bits (215),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 56/166 (34%), Positives = 83/166 (50%), Gaps = 8/166 (5%)

Query  1643  DECSNGDNLCQRNADCINSPGSYRCECAAGFKLSP-NGACVDRNECLEIPNVCSHGLCVD  1701
             D+C+ G + CQ    C+N+   + C C  G+KL+  N +C+  + C E  + C H  CV+
Sbjct  217   DQCAEGGHGCQHQ--CVNAWAMFHCTCNPGYKLAADNKSCLAIDLCAEGTHGCEHH-CVN  273

Query  1702  MQGSYKCICHNGFKASQDQTMCMDVDECE--RHPCGNGTCKNTVGSYNCLCYPGFELTHN  1759
               GSY C C  GF   QDQ  C  +D C    H C +  C +T G   C C  G +L  +
Sbjct  274   SPGSYFCHCQVGFVLQQDQRSCRAIDYCSFGNHSCQH-ECVSTPGGPRCHCREGHDLQPD  332

Query  1760  NDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNC  1805
                  + +  +     C   +C +E  S++CLC EG +L  DGK+C
Sbjct  333   GRSCQVRDLCNGVDHGCEF-QCVSEGLSYRCLCPEGRQLQADGKSC  377


 Score = 85.5 bits (210),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 60/195 (31%), Positives = 96/195 (49%), Gaps = 10/195 (5%)

Query  1684  RNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECER--HPCGNGTCKN  1741
             +++C E  + C H  CV+    + C C+ G+K + D   C+ +D C    H C +  C N
Sbjct  216   KDQCAEGGHGCQHQ-CVNAWAMFHCTCNPGYKLAADNKSCLAIDLCAEGTHGCEH-HCVN  273

Query  1742  TVGSYNCLCYPGFELTHNN-DCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTL  1800
             + GSY C C  GF L  +   C  ID CS  FG       C +  G  +C C EG++L  
Sbjct  274   SPGSYFCHCQVGFVLQQDQRSCRAIDYCS--FGNHSCQHECVSTPGGPRCHCREGHDLQP  331

Query  1801  DGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSE--SCIDINECNEDPNIC  1858
             DG++C   + C  +   C    C +   S+RC+CP G +++++  SC    E + D  + 
Sbjct  332   DGRSCQVRDLCNGVDHGCE-FQCVSEGLSYRCLCPEGRQLQADGKSCNRCREGHVDLVLL  390

Query  1859  LFGSCTNTPGGFQCI  1873
             + GS +  P  F+ +
Sbjct  391   VDGSKSVRPQNFELV  405


 Score = 85.5 bits (210),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 47/132 (36%), Positives = 64/132 (48%), Gaps = 4/132 (3%)

Query  368  DECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINED  427
            D+C + G  C++ +CVN    F C CN G++L  D K+C+  D C          C+N  
Sbjct  217  DQCAEGGHGCQH-QCVNAWAMFHCTCNPGYKLAADNKSCLAIDLCAEGTHGCEHHCVNSP  275

Query  428  GSFKCICKPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCECPPGLAVGVDGRV  487
            GS+ C C+ GFVL  + R C  ID C          C++T G  RC C  G  +  DGR 
Sbjct  276  GSYFCHCQVGFVLQQDQRSCRAIDYCSFGNHSCQHECVSTPGGPRCHCREGHDLQPDGRS  335

Query  488  CVDTHMRSTCYG  499
            C    +R  C G
Sbjct  336  C---QVRDLCNG  344


 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 55/167 (33%), Positives = 78/167 (47%), Gaps = 22/167 (13%)

Query  879   KCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGT------CVNTPGSFECE  932
             +C N    F C CN G+ L  + ++C  I       DLC  GT      CVN+PGS+ C 
Sbjct  229   QCVNAWAMFHCTCNPGYKLAADNKSCLAI-------DLCAEGTHGCEHHCVNSPGSYFCH  281

Query  933   CFDGYESGFMM---MKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREEC  989
             C    + GF++    ++C  ID C      C+   CV+T G  +C C  GH+L P    C
Sbjct  282   C----QVGFVLQQDQRSCRAIDYCSFGNHSCQ-HECVSTPGGPRCHCREGHDLQPDGRSC  336

Query  990   IDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDE  1036
                + C+  D  C   +CV+   +Y+C C  G Q   D +SC    E
Sbjct  337   QVRDLCNGVDHGCEF-QCVSEGLSYRCLCPEGRQLQADGKSCNRCRE  382


 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 47/143 (33%), Positives = 67/143 (47%), Gaps = 5/143 (3%)

Query  1582  CGNIPGFTFDIHSGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCED  1641
             C   PG+     +   + ID C E    C +  C+N  GS+ C C  GF        C  
Sbjct  239   CTCNPGYKLAADNKSCLAIDLCAEGTHGCEHH-CVNSPGSYFCHCQVGFVLQQDQRSCRA  297

Query  1642  IDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNG-ACVDRNECLEIPNVCSHGLCV  1700
             ID CS G++ CQ   +C+++PG  RC C  G  L P+G +C  R+ C  + + C    CV
Sbjct  298   IDYCSFGNHSCQH--ECVSTPGGPRCHCREGHDLQPDGRSCQVRDLCNGVDHGCEFQ-CV  354

Query  1701  DMQGSYKCICHNGFKASQDQTMC  1723
                 SY+C+C  G +   D   C
Sbjct  355   SEGLSYRCLCPEGRQLQADGKSC  377


 Score = 68.9 bits (167),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 83/180 (46%), Gaps = 10/180 (6%)

Query  1718  QDQTMCMDVDECER--HPCGNGTCKNTVGSYNCLCYPGFELTHNN-DCMDIDECSSFFGQ  1774
             Q Q+     D+C    H C +  C N    ++C C PG++L  +N  C+ ID C+   G 
Sbjct  208   QFQSRLCGKDQCAEGGHGCQH-QCVNAWAMFHCTCNPGYKLAADNKSCLAIDLCAE--GT  264

Query  1775  VCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCIC  1834
                   C N  GS+ C C  G+ L  D ++C   + C     SC    C +  G  RC C
Sbjct  265   HGCEHHCVNSPGSYFCHCQVGFVLQQDQRSCRAIDYCSFGNHSCQ-HECVSTPGGPRCHC  323

Query  1835  PPGYEVKSE--SCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQ  1892
               G++++ +  SC   + CN   + C F  C +    ++C+CP G  L  +G+ C   R+
Sbjct  324   REGHDLQPDGRSCQVRDLCNGVDHGCEF-QCVSEGLSYRCLCPEGRQLQADGKSCNRCRE  382


 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 52/159 (33%), Positives = 68/159 (43%), Gaps = 8/159 (5%)

Query  1601  DECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCIN  1660
             D+C E    C +  C+N    F C C  G+        C  ID C+ G + C+ +  C+N
Sbjct  217   DQCAEGGHGCQHQ-CVNAWAMFHCTCNPGYKLAADNKSCLAIDLCAEGTHGCEHH--CVN  273

Query  1661  SPGSYRCECAAGFKLSPNG-ACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQD  1719
             SPGSY C C  GF L  +  +C   + C    + C H  CV   G  +C C  G     D
Sbjct  274   SPGSYFCHCQVGFVLQQDQRSCRAIDYCSFGNHSCQHE-CVSTPGGPRCHCREGHDLQPD  332

Query  1720  QTMCMDVDECE--RHPCGNGTCKNTVGSYNCLCYPGFEL  1756
                C   D C    H C    C +   SY CLC  G +L
Sbjct  333   GRSCQVRDLCNGVDHGC-EFQCVSEGLSYRCLCPEGRQL  370


 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 46/156 (29%), Positives = 63/156 (40%), Gaps = 9/156 (6%)

Query  575  CENLRGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVF  634
            C N    + C CN GY+     ++C+ ID C+     C++  C N+PGSY C C  G+V 
Sbjct  230  CVNAWAMFHCTCNPGYKLAADNKSCLAIDLCAEGTHGCEHH-CVNSPGSYFCHCQVGFVL  288

Query  635  STETDTCEDINECE-SSPCVNGACRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNI  693
              +  +C  I+ C   +      C +  G   C C  G  L   G  C   ++  C  N 
Sbjct  289  QQDQRSCRAIDYCSFGNHSCQHECVSTPGGPRCHCREGHDLQPDGRSC--QVRDLC--NG  344

Query  694  QDSRCEVNINGATLKSECCATLG---AAWGSPCERC  726
             D  CE       L   C    G    A G  C RC
Sbjct  345  VDHGCEFQCVSEGLSYRCLCPEGRQLQADGKSCNRC  380


 Score = 62.8 bits (151),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 57/213 (27%), Positives = 80/213 (38%), Gaps = 43/213 (20%)

Query  410  DECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEG  469
            D+C          C+N    F C C PG+ LA + + C  ID C         HC+N+ G
Sbjct  217  DQCAEGGHGCQHQCVNAWAMFHCTCNPGYKLAADNKSCLAIDLCAEGTHGCEHHCVNSPG  276

Query  470  SFRCECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFG  529
            S+ C C  G  +  D R C     R+  Y      +C             C + P    G
Sbjct  277  SYFCHCQVGFVLQQDQRSC-----RAIDYCSFGNHSCQHE----------CVSTPG---G  318

Query  530  EPCHPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICSNGI-------CENLRGSY  582
              CH             C  G  +  DGR    C +  D+C NG+       C +   SY
Sbjct  319  PRCH-------------CREGHDLQPDGR---SCQVR-DLC-NGVDHGCEFQCVSEGLSY  360

Query  583  RCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNG  615
            RC C  G +    G++C    E  V+ +L  +G
Sbjct  361  RCLCPEGRQLQADGKSCNRCREGHVDLVLLVDG  393


 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 51/182 (28%), Positives = 72/182 (40%), Gaps = 36/182 (20%)

Query  1823  CQNLEGSFRCICPPGYEVKSE--SCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVL  1880
             C N    F C C PGY++ ++  SC+ I+ C E  + C    C N+PG + C C  GFVL
Sbjct  230   CVNAWAMFHCTCNPGYKLAADNKSCLAIDLCAEGTHGCEH-HCVNSPGSYFCHCQVGFVL  288

Query  1881  SDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEV  1940
               + R C    ++  + +F N  C           +C C     EG     +L P     
Sbjct  289   QQDQRSC----RAIDYCSFGNHSCQHECVSTPGGPRCHCR----EGH----DLQPDGRSC  336

Query  1941  AFQDLCPYGHGTIPGIDDTREDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGV  2000
               +DLC        G+D   E                C++   S+RC CP G  L   G 
Sbjct  337   QVRDLCN-------GVDHGCE--------------FQCVSEGLSYRCLCPEGRQLQADGK  375

Query  2001  HC  2002
              C
Sbjct  376   SC  377


 Score = 50.8 bits (120),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 45/156 (29%), Positives = 60/156 (38%), Gaps = 7/156 (4%)

Query  31   CATIGRAWGHPCEMCPAQPQ-PCRRGFIPNIRTGACQDVDECQAIPGVCQGGNCINTVGS  89
            CA  G    H C    A     C  G+       +C  +D C      C+  +C+N+ GS
Sbjct  219  CAEGGHGCQHQCVNAWAMFHCTCNPGYKLAADNKSCLAIDLCAEGTHGCEH-HCVNSPGS  277

Query  90   YECKCPAGHKQNEATQKCDDIDECSIIPGICEGSECSNTVGSYFCICPRGYVTSTDGSRC  149
            Y C C  G    +  + C  ID CS     C+  EC +T G   C C  G+    DG  C
Sbjct  278  YFCHCQVGFVLQQDQRSCRAIDYCSFGNHSCQ-HECVSTPGGPRCHCREGHDLQPDGRSC  336

Query  150  IDQRASTCFSNIVNGRCAQELPGRFTKRQCCCESGR  185
              Q    C  N V+  C  +        +C C  GR
Sbjct  337  --QVRDLC--NGVDHGCEFQCVSEGLSYRCLCPEGR  368


 Score = 49.7 bits (117),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 43/98 (44%), Gaps = 2/98 (2%)

Query  52   CRRGFIPNIRTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDID  111
            C+ GF+      +C+ +D C      CQ   C++T G   C C  GH      + C   D
Sbjct  282  CQVGFVLQQDQRSCRAIDYCSFGNHSCQH-ECVSTPGGPRCHCREGHDLQPDGRSCQVRD  340

Query  112  ECSIIPGICEGSECSNTVGSYFCICPRGYVTSTDGSRC  149
             C+ +   CE  +C +   SY C+CP G     DG  C
Sbjct  341  LCNGVDHGCE-FQCVSEGLSYRCLCPEGRQLQADGKSC  377


> sp|Q14393|GAS6_HUMAN Growth arrest-specific protein 6 OS=Homo 
sapiens GN=GAS6 PE=1 SV=2
Length=721

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 88/165 (53%), Gaps = 21/165 (13%)

Query  1007  CVNMVGTYQCSCNSGYQATPDRRSC-TDIDECMIMNGGCHTHCTNSEGSYECSCSDGYAL  1065
             C +++G + C C +G+      R C  D++EC   NGGC   C N  GS+ CSC  G+ L
Sbjct  133   CQDLMGNFFCLCKAGWGG----RLCDKDVNECSQENGGCLQICHNKPGSFHCSCHSGFEL  188

Query  1066  MPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSN  1125
               D RTC DIDEC ++ + C   +C N+PG Y CLC +GF  S   K C DV+E      
Sbjct  189   SSDGRTCQDIDEC-ADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKACRDVDE------  241

Query  1126  ICMFGECE----NTKGSFICHCQLGYSVKKGTTGCTDVDECEIGA  1166
              C+ G CE    N+ GS+ CHC      + G     D+D CE+ A
Sbjct  242   -CLQGRCEQVCVNSPGSYTCHC----DGRGGLKLSQDMDTCELEA  281


 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 84/156 (54%), Gaps = 19/156 (12%)

Query  328  DECTSNPCSNG---DCVNTPGSYYCKCHAGFQRTPTKQAC-IDIDECIQNGVLCKNGRCV  383
            D+CT NPC       C +  G+++C C AG+      + C  D++EC Q     +NG C+
Sbjct  118  DQCTPNPCDRKGTQACQDLMGNFFCLCKAGW----GGRLCDKDVNECSQ-----ENGGCL  168

Query  384  ----NTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFV  439
                N  GSF C C++GFEL++DG+ C D DEC  +  C    C N  GS+ C+C  GF 
Sbjct  169  QICHNKPGSFHCSCHSGFELSSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDEGFA  228

Query  440  LAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCEC  475
             +   + C D+DEC   G C    C+N+ GS+ C C
Sbjct  229  YSSQEKACRDVDEC-LQGRCEQV-CVNSPGSYTCHC  262


 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 73/126 (58%), Gaps = 3/126 (2%)

Query  543  FHGLCSSGIGITVDGRDINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDI  602
            F  LC +G G  +  +D+NEC+ +   C   IC N  GS+ C+C+SG+E    GR C DI
Sbjct  140  FFCLCKAGWGGRLCDKDVNECSQENGGCLQ-ICHNKPGSFHCSCHSGFELSSDGRTCQDI  198

Query  603  DECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINECESSPCVNGACRNNLG  662
            DEC+ +   C    C+N PGSYSC C +G+ +S++   C D++EC    C    C N+ G
Sbjct  199  DECA-DSEACGEARCKNLPGSYSCLCDEGFAYSSQEKACRDVDECLQGRC-EQVCVNSPG  256

Query  663  SFNCEC  668
            S+ C C
Sbjct  257  SYTCHC  262


 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 80/138 (58%), Gaps = 8/138 (6%)

Query  1174  SCVNVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGF--  1231
             +C ++ G+F C C+ GW G  +   D++ECS     C     C N PGS+ C+C  GF  
Sbjct  132   ACQDLMGNFFCLCKAGW-GGRLCDKDVNECSQENGGCL--QICHNKPGSFHCSCHSGFEL  188

Query  1232  TGDGFTCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNI  1291
             + DG TC D+DECA++   C   +C N+PG+Y C C+ GF  +S  K+C+D++EC  Q  
Sbjct  189   SSDGRTCQDIDECADS-EACGEARCKNLPGSYSCLCDEGFAYSSQEKACRDVDEC-LQGR  246

Query  1292  CVFGTCNNLPGMFHCICD  1309
             C    C N PG + C CD
Sbjct  247   CE-QVCVNSPGSYTCHCD  263


 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 64/126 (51%), Gaps = 6/126 (5%)

Query  991   DVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTN  1050
             DVNECS  +  C    C N  G++ CSC+SG++ + D R+C DIDEC          C N
Sbjct  156   DVNECSQENGGCLQ-ICHNKPGSFHCSCHSGFELSSDGRTCQDIDECADSEACGEARCKN  214

Query  1051  SEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLC--YDGFMAS  1108
               GSY C C +G+A     + C D+DEC      C+   C N PG Y C C    G   S
Sbjct  215   LPGSYSCLCDEGFAYSSQEKACRDVDECLQGR--CE-QVCVNSPGSYTCHCDGRGGLKLS  271

Query  1109  MDMKTC  1114
              DM TC
Sbjct  272   QDMDTC  277


 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 82/156 (53%), Gaps = 10/156 (6%)

Query  1614  VCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGF  1673
              C + +G+F C C  G+      L  +D++ECS  +  C +   C N PGS+ C C +GF
Sbjct  132   ACQDLMGNFFCLCKAGWGGR---LCDKDVNECSQENGGCLQI--CHNKPGSFHCSCHSGF  186

Query  1674  KLSPNG-ACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERH  1732
             +LS +G  C D +EC +    C    C ++ GSY C+C  GF  S  +  C DVDEC + 
Sbjct  187   ELSSDGRTCQDIDECAD-SEACGEARCKNLPGSYSCLCDEGFAYSSQEKACRDVDECLQG  245

Query  1733  PCGNGTCKNTVGSYNCLC--YPGFELTHNNDCMDID  1766
              C    C N+ GSY C C    G +L+ + D  +++
Sbjct  246   RC-EQVCVNSPGSYTCHCDGRGGLKLSQDMDTCELE  280


 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 62/115 (54%), Gaps = 8/115 (7%)

Query  863  KDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTC  922
            KD+NEC    G C+   C N  GSF C C+SGF L  + R C DIDEC  S + CG   C
Sbjct  155  KDVNECSQENGGCLQ-ICHNKPGSFHCSCHSGFELSSDGRTCQDIDECADS-EACGEARC  212

Query  923  VNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCR-GGTCVNTEGSFQCDC  976
             N PGS+ C C +G+       K C D+DEC    L  R    CVN+ GS+ C C
Sbjct  213  KNLPGSYSCLCDEGFAYS-SQEKACRDVDEC----LQGRCEQVCVNSPGSYTCHC  262


 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 85/161 (53%), Gaps = 29/161 (18%)

Query  1727  DECERHPC---GNGTCKNTVGSYNCLCYPGFELTHNNDC-MDIDECSSFFG---QVCRNG  1779
             D+C  +PC   G   C++ +G++ CLC  G+       C  D++ECS   G   Q+C N 
Sbjct  118   DQCTPNPCDRKGTQACQDLMGNFFCLCKAGW---GGRLCDKDVNECSQENGGCLQICHN-  173

Query  1780  RCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPG--  1837
                 + GSF C C+ G+EL+ DG+ C D +EC A   +C    C+NL GS+ C+C  G  
Sbjct  174   ----KPGSFHCSCHSGFELSSDGRTCQDIDEC-ADSEACGEARCKNLPGSYSCLCDEGFA  228

Query  1838  YEVKSESCIDINECNEDPNICLFGS----CTNTPGGFQCIC  1874
             Y  + ++C D++E       CL G     C N+PG + C C
Sbjct  229   YSSQEKACRDVDE-------CLQGRCEQVCVNSPGSYTCHC  262


 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 79/155 (51%), Gaps = 13/155 (8%)

Query  1076  DECESNPDICDGGQ-CTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECEN  1134
             D+C  NP    G Q C ++ G + CLC  G+   +  K   DVNEC   +  C+   C N
Sbjct  118   DQCTPNPCDRKGTQACQDLMGNFFCLCKAGWGGRLCDK---DVNECSQENGGCL-QICHN  173

Query  1135  TKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNG  1194
               GSF C C  G+ +      C D+DEC   +  C   A C N+PGS+ C C EG+  + 
Sbjct  174   KPGSFHCSCHSGFELSSDGRTCQDIDEC-ADSEACG-EARCKNLPGSYSCLCDEGFAYSS  231

Query  1195  IK--CIDLDECSNGTHQCSVNAQCVNSPGSYLCAC  1227
              +  C D+DEC  G  +C     CVNSPGSY C C
Sbjct  232   QEKACRDVDECLQG--RC--EQVCVNSPGSYTCHC  262


 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 55/110 (50%), Gaps = 5/110 (5%)

Query  1256  CLNVPGAYRCECEMGFTPASDSKSC-QDINECSFQNICVFGTCNNLPGMFHCICDDGYEL  1314
             C ++ G + C C+ G+      + C +D+NECS +N      C+N PG FHC C  G+EL
Sbjct  133   CQDLMGNFFCLCKAGW----GGRLCDKDVNECSQENGGCLQICHNKPGSFHCSCHSGFEL  188

Query  1315  DRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVD  1364
                G  C D+DECAD   C    C N PG Y C C   F  +     C D
Sbjct  189   SSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKACRD  238


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 76/159 (48%), Gaps = 19/159 (12%)

Query  339  DCVNTPGSYYCKCHAGF----QRTPTKQACIDIDECIQNGVLCKNGR-CVNTDGSFQCIC  393
            DC+N  GS Y K ++GF    Q  P        D+C  N    K  + C +  G+F C+C
Sbjct  94   DCINKYGSPYTK-NSGFATCVQNLP--------DQCTPNPCDRKGTQACQDLMGNFFCLC  144

Query  394  NAGFELTTDGKNC-VDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDIDE  452
             AG+     G+ C  D +EC+  N     +C N+ GSF C C  GF L+ +GR C DIDE
Sbjct  145  KAGW----GGRLCDKDVNECSQENGGCLQICHNKPGSFHCSCHSGFELSSDGRTCQDIDE  200

Query  453  CQTSGICMNGHCINTEGSFRCECPPGLAVGVDGRVCVDT  491
            C  S  C    C N  GS+ C C  G A     + C D 
Sbjct  201  CADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKACRDV  239


 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 59/108 (55%), Gaps = 15/108 (14%)

Query  307  SYRCECNMGYKQDSNGD-CTDVDECT-SNPCSNGDCVNTPGSYYCKCHAGFQRTPTKQAC  364
            S+ C C+ G++  S+G  C D+DEC  S  C    C N PGSY C C  GF  +  ++AC
Sbjct  177  SFHCSCHSGFELSSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKAC  236

Query  365  IDIDECIQNGVLCKNGR----CVNTDGSFQCICN--AGFELTTDGKNC  406
             D+DEC+Q       GR    CVN+ GS+ C C+   G +L+ D   C
Sbjct  237  RDVDECLQ-------GRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTC  277


 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 39/74 (53%), Gaps = 1/74 (1%)

Query  1961  EDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGNGTCT  2020
             +DVNEC +  G C    C N  GSF C C  G+ L   G  C D DEC+    CG   C 
Sbjct  155   KDVNECSQENGGCLQ-ICHNKPGSFHCSCHSGFELSSDGRTCQDIDECADSEACGEARCK  213

Query  2021  NVIGSFECNCHEGF  2034
             N+ GS+ C C EGF
Sbjct  214   NLPGSYSCLCDEGF  227


 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 72/155 (46%), Gaps = 13/155 (8%)

Query  880   CRNTIGSFKCKCNSGFTLDMEERNC-TDIDECWISPDLCGSGTCVNTPGSFECECFDGYE  938
             C++ +G+F C C +G+      R C  D++EC      C    C N PGSF C C  G+E
Sbjct  133   CQDLMGNFFCLCKAGWG----GRLCDKDVNECSQENGGCLQ-ICHNKPGSFHCSCHSGFE  187

Query  939   SGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLS  998
                   + C DIDEC  +   C    C N  GS+ C C  G   S   + C DV+EC   
Sbjct  188   LS-SDGRTCQDIDECA-DSEACGEARCKNLPGSYSCLCDEGFAYSSQEKACRDVDEC--L  243

Query  999   DSLCRNGKCVNMVGTYQCSCN--SGYQATPDRRSC  1031
                C    CVN  G+Y C C+   G + + D  +C
Sbjct  244   QGRCEQ-VCVNSPGSYTCHCDGRGGLKLSQDMDTC  277


 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 2/87 (2%)

Query  1440  EDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTC  1499
             +D++EC +  G C    C N  GSF C C  G+ LS + R C+DIDEC A    CG   C
Sbjct  155   KDVNECSQENGGCLQ-ICHNKPGSFHCSCHSGFELSSDGRTCQDIDEC-ADSEACGEARC  212

Query  1500  YNTLGNYTCICPPEYMQVNGGHNCMDM  1526
              N  G+Y+C+C   +   +    C D+
Sbjct  213   KNLPGSYSCLCDEGFAYSSQEKACRDV  239


 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 73/173 (42%), Gaps = 15/173 (9%)

Query  66   QDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICEGSEC  125
            +DV+EC    G C    C N  GS+ C C +G + +   + C DIDEC+     C  + C
Sbjct  155  KDVNECSQENGGCLQ-ICHNKPGSFHCSCHSGFELSSDGRTCQDIDECADSEA-CGEARC  212

Query  126  SNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQ---ELPGRFTKRQCCCE  182
             N  GSY C+C  G+  S+    C D          + GRC Q     PG +T   C C+
Sbjct  213  KNLPGSYSCLCDEGFAYSSQEKACRD------VDECLQGRCEQVCVNSPGSYT---CHCD  263

Query  183  SGRCWAMGSVPEMCPVRGSDEYRRLCVDGAPAGGGSRGG-GTGGNGFLPSGNG  234
                  +    + C +       R   DG+PA    RG  G+   G +P   G
Sbjct  264  GRGGLKLSQDMDTCELEAGWPCPRHRRDGSPAARPGRGAQGSRSEGHIPDRRG  316


 Score = 49.7 bits (117),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 45/85 (53%), Gaps = 12/85 (14%)

Query  1814  LPGSCSPG--------TCQNLEGSFRCICPPGYEVKSESC-IDINECNEDPNICLFGSCT  1864
             LP  C+P          CQ+L G+F C+C  G+      C  D+NEC+++   CL   C 
Sbjct  116   LPDQCTPNPCDRKGTQACQDLMGNFFCLCKAGW--GGRLCDKDVNECSQENGGCL-QICH  172

Query  1865  NTPGGFQCICPTGFVLSDNGRRCFD  1889
             N PG F C C +GF LS +GR C D
Sbjct  173   NKPGSFHCSCHSGFELSSDGRTCQD  197


> sp|P78504|JAG1_HUMAN Protein jagged-1 OS=Homo sapiens GN=JAG1 
PE=1 SV=3
Length=1218

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 175/610 (29%), Positives = 247/610 (40%), Gaps = 149/610 (24%)

Query  1441  DIDECQELPGLC-QGGNCINTFGSFQCECPKGYYLSEETRICE-DIDECVAHPGVCGPGT  1498
             +ID+C   P  C  GG C +    F+C CP  +      + C+ D +EC A P V    +
Sbjct  374   NIDDCS--PNNCSHGGTCQDLVNGFKCVCPPQW----TGKTCQLDANECEAKPCV-NAKS  426

Query  1499  CYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCY-RSYNGTSCENELPFNVTKRMCCCTY  1557
             C N + +Y C C P +M    G NC D+  + C  +  N  SC +     V    C C  
Sbjct  427   CKNLIASYYCDCLPGWM----GQNC-DININDCLGQCQNDASCRDL----VNGYRCICP-  476

Query  1558  NVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICANG-VCI  1616
                                         PG+  D H  +  DIDEC   P  C NG  C 
Sbjct  477   ----------------------------PGYAGD-HCER--DIDECASNP--CLNGGHCQ  503

Query  1617  NQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLS  1676
             N+I  F+C CPTGFS N   L   DID C    N CQ  A C N    Y C+C   +   
Sbjct  504   NEINRFQCLCPTGFSGNLCQL---DIDYCE--PNPCQNGAQCYNRASDYFCKCPEDY---  555

Query  1677  PNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPCGN  1736
                   +   C  + + C    C  +     C        + +    +  + C  H    
Sbjct  556   ------EGKNCSHLKDHCRTTPCEVIDS---CTVAMASNDTPEGVRYISSNVCGPH----  602

Query  1737  GTCKNTVG-SYNCLCYPGFELTHNNDCMDIDECSSFFGQVCRNG-RCFNEIGSFKCLCNE  1794
             G CK+  G  + C C  GF  T+ ++  +I++C S     CRNG  C + + S+KC+C++
Sbjct  603   GKCKSQSGGKFTCDCNKGFTGTYCHE--NINDCES---NPCRNGGTCIDGVNSYKCICSD  657

Query  1795  GYELTLDGKNC-IDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKS----ESCIDIN  1849
             G+E    G  C  + N+C   P   + GTC++L   F C C  G++ K+    +S  D  
Sbjct  658   GWE----GAYCETNINDCSQNPCH-NGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEA  712

Query  1850  ECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTN--FENGKCSVP  1907
              CN        G+C +    F+C+CP G+     G  C   R S C  N     G C V 
Sbjct  713   TCNNG------GTCYDEGDAFKCMCPGGW----EGTTCNIARNSSCLPNPCHNGGTCVV-  761

Query  1908  KAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECL  1967
                N     C C     EGW  P              +C              ++ N+C 
Sbjct  762   ---NGESFTCVCK----EGWEGP--------------ICA-------------QNTNDC-  786

Query  1968  ESPGVCSN-GHCINTDGSFRCECPMGYNLDYTGVHC-IDTDECSIGNPCGNG-TCTNVIG  2024
              SP  C N G C++ D  +RCEC  G+     G  C I+ +EC   +PC  G TC + I 
Sbjct  787   -SPHPCYNSGTCVDGDNWYRCECAPGF----AGPDCRININECQ-SSPCAFGATCVDEIN  840

Query  2025  SFECNCHEGF  2034
              + C C  G 
Sbjct  841   GYRCVCPPGH  850


 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 185/702 (26%), Positives = 276/702 (39%), Gaps = 158/702 (23%)

Query  570   CSNGICENLRGSYRCNCNSGYEPDPSGRNC-VDIDECSVNRLLCDNGLCRNT-PGSYSCT  627
             C +GIC      ++C C + +     G+ C  D++ C  ++   + G C NT P  Y C+
Sbjct  271   CVHGICNE---PWQCLCETNW----GGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCS  323

Query  628   CPKGYVFSTETDTCEDI-NECESSPCVN-GACRNNLGSFNCECSPGSKLDSTGLICIDSL  685
             CP+GY        CE   + C S PC N G+C+     F CECSPG     TG       
Sbjct  324   CPEGY----SGPNCEIAEHACLSDPCHNRGSCKETSLGFECECSPGW----TGP------  369

Query  686   KGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVNGVTCE  745
               TC  NI D       +G T     C  L   +   C              +  G TC+
Sbjct  370   --TCSTNIDDCSPNNCSHGGT-----CQDLVNGFKCVCP------------PQWTGKTCQ  410

Query  746   -DVNECDVFPGVCPNGR-CINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLTWDEDEC  803
              D NEC+  P  C N + C N   S++C+C  G      G+ C DI +  C      D  
Sbjct  411   LDANECEAKP--CVNAKSCKNLIASYYCDCLPGWM----GQNC-DININDCLGQCQNDAS  463

Query  804   IRSVPGKFRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFYK  863
              R +   +R   C C  G A G  CE                                 +
Sbjct  464   CRDLVNGYR---CICPPGYA-GDHCE---------------------------------R  486

Query  864   DINECKVFPGMCMNG-KCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGT-  921
             DI+EC   P  C+NG  C+N I  F+C C +GF+ ++ +    DID C   P+ C +G  
Sbjct  487   DIDECASNP--CLNGGHCQNEINRFQCLCPTGFSGNLCQ---LDIDYC--EPNPCQNGAQ  539

Query  922   CVNTPGSFECECFDGYESGFMMMKNCMDI-DECERNPLLC--------------------  960
             C N    + C+C + YE      KNC  + D C   P                       
Sbjct  540   CYNRASDYFCKCPEDYEG-----KNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYI  594

Query  961   -------RGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNG-KCVNMVG  1012
                     G     + G F CDC  G   +   E   ++N+C    + CRNG  C++ V 
Sbjct  595   SSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYCHE---NINDCE--SNPCRNGGTCIDGVN  649

Query  1013  TYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTC  1072
             +Y+C C+ G++      +  D  +    NGG    C +    + C C +G+      +TC
Sbjct  650   SYKCICSDGWEGAYCETNINDCSQNPCHNGGT---CRDLVNDFYCDCKNGWK----GKTC  702

Query  1073  ADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMF-GE  1131
                D         +GG C +    ++C+C  G+  +    TC          N C   G 
Sbjct  703   HSRDSQCDEATCNNGGTCYDEGDAFKCMCPGGWEGT----TCNIARNSSCLPNPCHNGGT  758

Query  1132  CENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWV  1191
             C     SF C C+ G+   +G     + ++C    H C    +CV+    ++C C  G+ 
Sbjct  759   CVVNGESFTCVCKEGW---EGPICAQNTNDCS--PHPCYNSGTCVDGDNWYRCECAPGFA  813

Query  1192  GNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTG  1233
             G   + I+++EC   +  C+  A CV+    Y C C  G +G
Sbjct  814   GPDCR-ININECQ--SSPCAFGATCVDEINGYRCVCPPGHSG  852


 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 145/547 (27%), Positives = 224/547 (41%), Gaps = 120/547 (22%)

Query  878   GKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSG-TCVNTPGSFECECFDG  936
             G C+ T   F+C+C+ G+T        T+ID+C  SP+ C  G TC +    F+C C   
Sbjct  349   GSCKETSLGFECECSPGWTGPTCS---TNIDDC--SPNNCSHGGTCQDLVNGFKCVCPPQ  403

Query  937   YESGFMMMKNC-MDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREEC-IDVNE  994
             +       K C +D +ECE  P +    +C N   S+ CDC  G       + C I++N+
Sbjct  404   WTG-----KTCQLDANECEAKPCV-NAKSCKNLIASYYCDCLPGW----MGQNCDININD  453

Query  995   CSLSDSLCRN-GKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMI---MNGGCHTHCTN  1050
             C      C+N   C ++V  Y+C C  GY      R   DIDEC     +NGG   HC N
Sbjct  454   CL---GQCQNDASCRDLVNGYRCICPPGYAGDHCER---DIDECASNPCLNGG---HCQN  504

Query  1051  SEGSYECSCSDGYALMPDVRTCA-DIDECESNPDICDGGQCTNIPGEYRCLCYDGF----  1105
                 ++C C  G++       C  DID CE NP   +G QC N   +Y C C + +    
Sbjct  505   EINRFQCLCPTGFS----GNLCQLDIDYCEPNP-CQNGAQCYNRASDYFCKCPEDYEGKN  559

Query  1106  ----------------------MASMDMKTCIDVNECDLNSNIC-MFGECENTKG-SFIC  1141
                                   MAS D    +      ++SN+C   G+C++  G  F C
Sbjct  560   CSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRY----ISSNVCGPHGKCKSQSGGKFTC  615

Query  1142  HCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIKCIDLD  1201
              C  G++   GT    ++++CE  ++ C    +C++   S+KC C +GW G   +  +++
Sbjct  616   DCNKGFT---GTYCHENINDCE--SNPCRNGGTCIDGVNSYKCICSDGWEGAYCE-TNIN  669

Query  1202  ECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECAENVHLCENGQCLNVPG  1261
             +CS   + C     C +    + C C  G+ G   TC   D   +       G C +   
Sbjct  670   DCSQ--NPCHNGGTCRDLVNDFYCDCKNGWKGK--TCHSRDSQCDEATCNNGGTCYDEGD  725

Query  1262  AYRCECEMGF---------------TPASDSKSC---------------------QDINE  1285
             A++C C  G+                P  +  +C                     Q+ N+
Sbjct  726   AFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICAQNTND  785

Query  1286  CSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNC-TDVDECADPINCVNGLCVNTPGR  1344
             CS       GTC +    + C C  G+     G +C  +++EC          CV+    
Sbjct  786   CSPHPCYNSGTCVDGDNWYRCECAPGF----AGPDCRININECQSSPCAFGATCVDEING  841

Query  1345  YECNCPP  1351
             Y C CPP
Sbjct  842   YRCVCPP  848


 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 167/626 (27%), Positives = 259/626 (41%), Gaps = 105/626 (17%)

Query  1464  FQCECPKGYYL-------SEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYM-  1515
             F    P+ Y L       S +T   + I E  +H G+  P   + TL   T +   EY  
Sbjct  124   FSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQI  183

Query  1516  ---------------------QVNGGHNCMDMRKSFCYRSYNGTSCENEL------PFNV  1548
                                     G + C       C   + G  C   +      P + 
Sbjct  184   RVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHG  243

Query  1549  TKRM---CCCTYNVGKAWNKPCEPC-PTPGTAEFKNICGNIPGFTFDIHSGKAV---DID  1601
             + ++   C C Y     +   C+ C P PG      IC        + + G  +   D++
Sbjct  244   SCKLPGDCRCQYGWQGLY---CDKCIPHPGCVH--GICNEPWQCLCETNWGGQLCDKDLN  298

Query  1602  ECKEIPGICANGVCINQ-IGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCIN  1660
              C         G C N     ++C CP G+S  +    CE I E +   + C     C  
Sbjct  299   YCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPN----CE-IAEHACLSDPCHNRGSCKE  353

Query  1661  SPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSH-GLCVDMQGSYKCICHNGFKASQD  1719
             +   + CEC+ G+        +D  +C   PN CSH G C D+   +KC+C   +     
Sbjct  354   TSLGFECECSPGWTGPTCSTNID--DC--SPNNCSHGGTCQDLVNGFKCVCPPQWTG---  406

Query  1720  QTMCMDVDECERHPCGNG-TCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSFFGQVCRN  1778
             +T  +D +ECE  PC N  +CKN + SY C C PG+ +  N D ++I++C    GQ   +
Sbjct  407   KTCQLDANECEAKPCVNAKSCKNLIASYYCDCLPGW-MGQNCD-ININDC---LGQCQND  461

Query  1779  GRCFNEIGSFKCLCNEGYELTLDGKNC-IDTNECVALPGSCSPGTCQNLEGSFRCICPPG  1837
               C + +  ++C+C  GY     G +C  D +EC + P   + G CQN    F+C+CP G
Sbjct  462   ASCRDLVNGYRCICPPGYA----GDHCERDIDECASNP-CLNGGHCQNEINRFQCLCPTG  516

Query  1838  YEVKSESCIDINECNEDPNICLFGS-CTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCF  1896
             +   +   +DI+ C  +PN C  G+ C N    + C CP  +     G+ C   +     
Sbjct  517   FS-GNLCQLDIDYC--EPNPCQNGAQCYNRASDYFCKCPEDY----EGKNCSHLKDHCRT  569

Query  1897  TNFEN-GKCSVPKAFNTTK--AKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGH-GT  1952
             T  E    C+V  A N T    +   S + G     P   C  +    F   C  G  GT
Sbjct  570   TPCEVIDSCTVAMASNDTPEGVRYISSNVCG-----PHGKCKSQSGGKFTCDCNKGFTGT  624

Query  1953  IPGIDDTREDVNECLESPGVCSN-GHCINTDGSFRCECPMGYNLDYTGVHC-IDTDECSI  2010
                     E++N+C  +P  C N G CI+   S++C C  G+     G +C  + ++CS 
Sbjct  625   Y-----CHENINDCESNP--CRNGGTCIDGVNSYKCICSDGWE----GAYCETNINDCS-  672

Query  2011  GNPCGN-GTCTNVIGSFECNCHEGFE  2035
              NPC N GTC +++  F C+C  G++
Sbjct  673   QNPCHNGGTCRDLVNDFYCDCKNGWK  698


 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 141/501 (28%), Positives = 197/501 (39%), Gaps = 123/501 (25%)

Query  1621  SFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGA  1680
              ++C CP G+S  +    CE I E +   + C     C  +   + CEC+ G+       
Sbjct  319   KYQCSCPEGYSGPN----CE-IAEHACLSDPCHNRGSCKETSLGFECECSPGWTGPTCST  373

Query  1681  CVDRNECLEIPNVCSHG-LCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPCGNG-T  1738
              +D  +C   PN CSHG  C D+   +KC+C   +     +T  +D +ECE  PC N  +
Sbjct  374   NID--DCS--PNNCSHGGTCQDLVNGFKCVCPPQWTG---KTCQLDANECEAKPCVNAKS  426

Query  1739  CKNTVGSYNCLCYPGFELTHN-----NDCM------------------------------  1763
             CKN + SY C C PG+ +  N     NDC+                              
Sbjct  427   CKNLIASYYCDCLPGW-MGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYAGDHCE  485

Query  1764  -DIDECSSFFGQVCRNG-RCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPG  1821
              DIDEC+S     C NG  C NEI  F+CLC  G+   L     +D + C   P  C  G
Sbjct  486   RDIDECAS---NPCLNGGHCQNEINRFQCLCPTGFSGNLCQ---LDIDYCE--PNPCQNG  537

Query  1822  T-CQNLEGSFRCICPPGYEVKS----------------ESCIDINECNEDP--------N  1856
               C N    + C CP  YE K+                +SC      N+ P        N
Sbjct  538   AQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSN  597

Query  1857  IC-LFGSCTNTPGG-FQCICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTK  1914
             +C   G C +  GG F C C  GF     G  C +           NG   +        
Sbjct  598   VCGPHGKCKSQSGGKFTCDCNKGFT----GTYCHENINDCESNPCRNGGTCID---GVNS  650

Query  1915  AKCCCSKMPGEGW-------------GDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTRE  1961
              KC CS    +GW              +PC       ++     C   +G       +R+
Sbjct  651   YKCICS----DGWEGAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRD  706

Query  1962  DVNECLESPGVCSNG-HCINTDGSFRCECPMGYNLDYTGVHC-IDTDECSIGNPCGNG-T  2018
               ++C E+   C+NG  C +   +F+C CP G+     G  C I  +   + NPC NG T
Sbjct  707   --SQCDEA--TCNNGGTCYDEGDAFKCMCPGGWE----GTTCNIARNSSCLPNPCHNGGT  758

Query  2019  CTNVIGSFECNCHEGFEPGPM  2039
             C     SF C C EG+E GP+
Sbjct  759   CVVNGESFTCVCKEGWE-GPI  778


 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 104/387 (27%), Positives = 159/387 (41%), Gaps = 80/387 (21%)

Query  294  DLCLN-GRCIPTLSSYRCECNMGYKQDSNGDCTDVDECTSNPCSNG-DCVNTPGSYYCKC  351
            D C N G C  T   + CEC+ G+   +    T++D+C+ N CS+G  C +    + C C
Sbjct  343  DPCHNRGSCKETSLGFECECSPGWTGPTCS--TNIDDCSPNNCSHGGTCQDLVNGFKCVC  400

Query  352  HAGFQRTPTKQAC-IDIDECIQNGVLCKNGR-CVNTDGSFQCICNAGFELTTDGKNC-VD  408
               +    T + C +D +EC      C N + C N   S+ C C  G+     G+NC ++
Sbjct  401  PPQW----TGKTCQLDANEC--EAKPCVNAKSCKNLIASYYCDCLPGWM----GQNCDIN  450

Query  409  HDECTTTNMCLN-GMCINEDGSFKCICKPGFVLAPNGRYC-TDIDECQTSGICMNGHCIN  466
             ++C     C N   C +    ++CIC PG+     G +C  DIDEC ++     GHC N
Sbjct  451  INDCL--GQCQNDASCRDLVNGYRCICPPGYA----GDHCERDIDECASNPCLNGGHCQN  504

Query  467  TEGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDY  526
                F+C CP G +  +                                    C  + DY
Sbjct  505  EINRFQCLCPTGFSGNL------------------------------------CQLDIDY  528

Query  527  GFGEPCHPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICSNGICENLRGSYRCNC  586
                 C P P +N A+ +   S       +  +   C+   D C    CE +     C  
Sbjct  529  -----CEPNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDS---CTV  580

Query  587  NSGYEPDPSGRNCVDIDECSVNRLLCDNGLCRNTP-GSYSCTCPKGYVFSTETDTCEDIN  645
                   P G   +  + C        +G C++   G ++C C KG+   T T   E+IN
Sbjct  581  AMASNDTPEGVRYISSNVCG------PHGKCKSQSGGKFTCDCNKGF---TGTYCHENIN  631

Query  646  ECESSPCVN-GACRNNLGSFNCECSPG  671
            +CES+PC N G C + + S+ C CS G
Sbjct  632  DCESNPCRNGGTCIDGVNSYKCICSDG  658


 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 75/291 (26%), Positives = 112/291 (38%), Gaps = 72/291 (25%)

Query  1073  ADIDECESNPDICDGGQCTNI-PGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICM---  1128
              D++ C ++    +GG C+N  P +Y+C C +G+              C++  + C+   
Sbjct  295   KDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGP----------NCEIAEHACLSDP  344

Query  1129  ---FGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCS  1185
                 G C+ T   F C C  G++   G T  T++D+C    +NC    +C ++   FKC 
Sbjct  345   CHNRGSCKETSLGFECECSPGWT---GPTCSTNIDDCS--PNNCSHGGTCQDLVNGFKCV  399

Query  1186  CREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECA  1245
             C   W G   + +D +EC      C     C N   SY C C+ G+ G          C 
Sbjct  400   CPPQWTGKTCQ-LDANECE--AKPCVNAKSCKNLIASYYCDCLPGWMGQ--------NCD  448

Query  1246  ENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFH  1305
              N++ C  GQC N                                     +C +L   + 
Sbjct  449   ININDCL-GQCQND-----------------------------------ASCRDLVNGYR  472

Query  1306  CICDDGYELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLN  1356
             CIC  GY  D       D+DECA       G C N   R++C CP  F  N
Sbjct  473   CICPPGYAGDHCE---RDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGN  520


 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 82/284 (29%), Positives = 125/284 (44%), Gaps = 52/284 (18%)

Query  410  DECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYC-TDIDECQTSGICMN-GHCINT  467
            D+C     C++G+C   +  ++C+C+  +     G+ C  D++ C T   C+N G C NT
Sbjct  263  DKCIPHPGCVHGIC---NEPWQCLCETNW----GGQLCDKDLNYCGTHQPCLNGGTCSNT  315

Query  468  -EGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDY  526
                ++C CP G + G +  +     +   C+    +G+C     G     EC C+    
Sbjct  316  GPDKYQCSCPEGYS-GPNCEIAEHACLSDPCH---NRGSCKETSLGF----ECECSP---  364

Query  527  GFGEP-----CHPCPAKNSAE----------FHGLCSSGIGITVDGRDINECALDPDICS  571
            G+  P        C   N +           F  +C           D NEC   P + +
Sbjct  365  GWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKPCVNA  424

Query  572  NGICENLRGSYRCNCNSGYEPDPSGRNC-VDIDECSVNRLLCDN-GLCRNTPGSYSCTCP  629
               C+NL  SY C+C  G+     G+NC ++I++C      C N   CR+    Y C CP
Sbjct  425  KS-CKNLIASYYCDCLPGW----MGQNCDININDCLGQ---CQNDASCRDLVNGYRCICP  476

Query  630  KGYVFSTETDTCE-DINECESSPCVNGA-CRNNLGSFNCECSPG  671
             GY      D CE DI+EC S+PC+NG  C+N +  F C C  G
Sbjct  477  PGYA----GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTG  516


> sp|P07225|PROS_HUMAN Vitamin K-dependent protein S OS=Homo sapiens 
GN=PROS1 PE=1 SV=1
Length=676

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 89/166 (54%), Gaps = 18/166 (11%)

Query  1002  CRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMI---MNGGCHTHCTNSEGSYECS  1058
             C++GK      ++ C+C  G+Q     +   DI+EC     +NGGC   C N+ GSY CS
Sbjct  134   CKDGK-----ASFTCTCKPGWQG---EKCEFDINECKDPSNINGGCSQICDNTPGSYHCS  185

Query  1059  CSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVN  1118
             C +G+ ++ + + C D+DEC   P IC    C NIPG++ C C +G+  ++  K+C D++
Sbjct  186   CKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDID  245

Query  1119  ECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEI  1164
             EC  + N+C    C N  G + C+C      KKG     D   CE+
Sbjct  246   EC--SENMCA-QLCVNYPGGYTCYC----DGKKGFKLAQDQKSCEV  284


 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 94/174 (54%), Gaps = 15/174 (9%)

Query  1168  NCDMHASCVNVPGSFKCSCREGWVGNGIKC-IDLDEC---SNGTHQCSVNAQCVNSPGSY  1223
             N D + SC +   SF C+C+ GW G   KC  D++EC   SN    CS    C N+PGSY
Sbjct  127   NEDGYMSCKDGKASFTCTCKPGWQGE--KCEFDINECKDPSNINGGCS--QICDNTPGSY  182

Query  1224  LCACVEGFT--GDGFTCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKSCQ  1281
              C+C  GF    +   C DVDEC+    +C    C N+PG + CEC  G+     SKSC+
Sbjct  183   HCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCE  242

Query  1282  DINECSFQNICVFGTCNNLPGMFHCICD--DGYELDRTGGNCTDVDECADPINC  1333
             DI+ECS +N+C    C N PG + C CD   G++L +   +C  V  C  P+N 
Sbjct  243   DIDECS-ENMCA-QLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCL-PLNL  293


 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 77/138 (56%), Gaps = 12/138 (9%)

Query  864  DINECKVFPGMCMNGKCR----NTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGS  919
            DINECK      +NG C     NT GS+ C C +GF +   +++C D+DEC + P +CG+
Sbjct  157  DINECK--DPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGT  214

Query  920  GTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDC--P  977
              C N PG FECEC +GY    +  K+C DIDEC  N  +C    CVN  G + C C   
Sbjct  215  AVCKNIPGDFECECPEGYRYN-LKSKSCEDIDECSEN--MC-AQLCVNYPGGYTCYCDGK  270

Query  978  LGHELSPSREECIDVNEC  995
             G +L+  ++ C  V+ C
Sbjct  271  KGFKLAQDQKSCEVVSVC  288


 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 78/140 (56%), Gaps = 12/140 (9%)

Query  1216  CVNSPGSYLCACVEGFTGDGFTCS-DVDECAENVHLCENGQCL----NVPGAYRCECEMG  1270
             C +   S+ C C  G+ G+   C  D++EC +  ++  NG C     N PG+Y C C+ G
Sbjct  134   CKDGKASFTCTCKPGWQGE--KCEFDINECKDPSNI--NGGCSQICDNTPGSYHCSCKNG  189

Query  1271  FTPASDSKSCQDINECSFQ-NICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDECAD  1329
             F   S+ K C+D++ECS + +IC    C N+PG F C C +GY  +    +C D+DEC++
Sbjct  190   FVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDECSE  249

Query  1330  PINCVNGLCVNTPGRYECNC  1349
               N    LCVN PG Y C C
Sbjct  250   --NMCAQLCVNYPGGYTCYC  267


 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 91/175 (52%), Gaps = 25/175 (14%)

Query  1727  DECERHPC---GNGTCKNTVGSYNCLCYPGFELTHNNDC-MDIDEC---SSFFG---QVC  1776
             D+C   PC   G  +CK+   S+ C C PG++      C  DI+EC   S+  G   Q+C
Sbjct  119   DQCSPLPCNEDGYMSCKDGKASFTCTCKPGWQ---GEKCEFDINECKDPSNINGGCSQIC  175

Query  1777  RNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPP  1836
              N       GS+ C C  G+ +  + K+C D +EC   P  C    C+N+ G F C CP 
Sbjct  176   DNTP-----GSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPE  230

Query  1837  GYE--VKSESCIDINECNEDPNICLFGSCTNTPGGFQCIC--PTGFVLSDNGRRC  1887
             GY   +KS+SC DI+EC+E  N+C    C N PGG+ C C    GF L+ + + C
Sbjct  231   GYRYNLKSKSCEDIDECSE--NMCA-QLCVNYPGGYTCYCDGKKGFKLAQDQKSC  282


 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 68/113 (60%), Gaps = 5/113 (4%)

Query  559  DINECALDPDICSNG---ICENLRGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNG  615
            DINEC  DP   + G   IC+N  GSY C+C +G+    + ++C D+DECS+   +C   
Sbjct  157  DINECK-DPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTA  215

Query  616  LCRNTPGSYSCTCPKGYVFSTETDTCEDINECESSPCVNGACRNNLGSFNCEC  668
            +C+N PG + C CP+GY ++ ++ +CEDI+EC  + C    C N  G + C C
Sbjct  216  VCKNIPGDFECECPEGYRYNLKSKSCEDIDECSENMCAQ-LCVNYPGGYTCYC  267


 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 82/166 (49%), Gaps = 12/166 (7%)

Query  918   GSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRGG---TCVNTEGSFQC  974
             G  +C +   SF C C  G++      K   DI+EC ++P    GG    C NT GS+ C
Sbjct  130   GYMSCKDGKASFTCTCKPGWQGE----KCEFDINEC-KDPSNINGGCSQICDNTPGSYHC  184

Query  975   DCPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDI  1034
              C  G  +  ++++C DV+ECSL  S+C    C N+ G ++C C  GY+     +SC DI
Sbjct  185   SCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDI  244

Query  1035  DECMIMNGGCHTHCTNSEGSYECSC--SDGYALMPDVRTCADIDEC  1078
             DEC      C   C N  G Y C C    G+ L  D ++C  +  C
Sbjct  245   DEC--SENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVC  288


 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 77/155 (50%), Gaps = 12/155 (8%)

Query  306  SSYRCECNMGYKQDSNGDCT-DVDECTSNPCSNGDCV----NTPGSYYCKCHAGFQRTPT  360
            +S+ C C  G++ +    C  D++EC      NG C     NTPGSY+C C  GF     
Sbjct  139  ASFTCTCKPGWQGEK---CEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSN  195

Query  361  KQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLN  420
            K+ C D+DEC     +C    C N  G F+C C  G+      K+C D DEC + NMC  
Sbjct  196  KKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDEC-SENMCAQ  254

Query  421  GMCINEDGSFKCIC--KPGFVLAPNGRYCTDIDEC  453
             +C+N  G + C C  K GF LA + + C  +  C
Sbjct  255  -LCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVC  288


 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 71/141 (50%), Gaps = 24/141 (17%)

Query  1580  NICGNIPGFT-------FDIHSGKA--VDIDECKEIPGICANGVCINQIGSFRCECPTGF  1630
              IC N PG         F + S K    D+DEC   P IC   VC N  G F CECP G+
Sbjct  173   QICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGY  232

Query  1631  SYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCEC--AAGFKLSPNGACVDRNECL  1688
              YN     CEDIDECS  +N+C +   C+N PG Y C C    GFKL+      D+  C 
Sbjct  233   RYNLKSKSCEDIDECS--ENMCAQ--LCVNYPGGYTCYCDGKKGFKLAQ-----DQKSC-  282

Query  1689  EIPNVCSHGLCVDMQGSYKCI  1709
             E+ +VC   L +++   Y+ +
Sbjct  283   EVVSVC---LPLNLDTKYELL  300


 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 83/169 (49%), Gaps = 17/169 (10%)

Query  1067  PDVRTCADI--DECESNPDICDGGQ-CTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLN  1123
             PD+R+C +   D+C   P   DG   C +    + C C  G+      K   D+NEC   
Sbjct  108   PDLRSCVNAIPDQCSPLPCNEDGYMSCKDGKASFTCTCKPGWQGE---KCEFDINECKDP  164

Query  1124  SNI---CMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPG  1180
             SNI   C    C+NT GS+ C C+ G+ +      C DVDEC +    C   A C N+PG
Sbjct  165   SNINGGCS-QICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGT-AVCKNIPG  222

Query  1181  SFKCSCREGWVGN--GIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCAC  1227
              F+C C EG+  N     C D+DECS   + C+    CVN PG Y C C
Sbjct  223   DFECECPEGYRYNLKSKSCEDIDECSE--NMCA--QLCVNYPGGYTCYC  267


 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 75/137 (55%), Gaps = 11/137 (8%)

Query  1599  DIDECKE---IPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRN  1655
             DI+ECK+   I G C+  +C N  GS+ C C  GF        C+D+DECS   ++C   
Sbjct  157   DINECKDPSNINGGCSQ-ICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICG-T  214

Query  1656  ADCINSPGSYRCECAAGFKLS-PNGACVDRNECLEIPNVCSHGLCVDMQGSYKCIC--HN  1712
             A C N PG + CEC  G++ +  + +C D +EC E  N+C+  LCV+  G Y C C    
Sbjct  215   AVCKNIPGDFECECPEGYRYNLKSKSCEDIDECSE--NMCAQ-LCVNYPGGYTCYCDGKK  271

Query  1713  GFKASQDQTMCMDVDEC  1729
             GFK +QDQ  C  V  C
Sbjct  272   GFKLAQDQKSCEVVSVC  288


 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 75/168 (45%), Gaps = 11/168 (7%)

Query  307  SYRCECNMGYKQDSNG-DCTDVDECTSNP--CSNGDCVNTPGSYYCKCHAGFQRTPTKQA  363
            SY C C  G+   SN  DC DVDEC+  P  C    C N PG + C+C  G++     ++
Sbjct  181  SYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKS  240

Query  364  CIDIDECIQNGVLCKNGRCVNTDGSFQCICN--AGFELTTDGKNCVDHDECTTTNMCLNG  421
            C DIDEC +N  +C    CVN  G + C C+   GF+L  D K+C     C   N+    
Sbjct  241  CEDIDECSEN--MCAQ-LCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKY  297

Query  422  MCINEDGSFK-CICKPGFVLAPNGRYCTDID--ECQTSGICMNGHCIN  466
              +     F   +    F L    R+  + D     + G+ +    I+
Sbjct  298  ELLYLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESID  345


 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 72/148 (49%), Gaps = 14/148 (9%)

Query  1620  GSFRCECPTGFSYNDLLLVCE-DIDECSNGDNL---CQRNADCINSPGSYRCECAAGF-K  1674
              SF C C  G+        CE DI+EC +  N+   C +   C N+PGSY C C  GF  
Sbjct  139   ASFTCTCKPGWQGEK----CEFDINECKDPSNINGGCSQ--ICDNTPGSYHCSCKNGFVM  192

Query  1675  LSPNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPC  1734
             LS    C D +EC   P++C   +C ++ G ++C C  G++ +     C D+DEC  + C
Sbjct  193   LSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDECSENMC  252

Query  1735  GNGTCKNTVGSYNCLC--YPGFELTHNN  1760
                 C N  G Y C C    GF+L  + 
Sbjct  253   AQ-LCVNYPGGYTCYCDGKKGFKLAQDQ  279


 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 5/100 (5%)

Query  52   CRRGFIPNIRTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAGHKQNEATQKCDDID  111
            C+ GF+       C+DVDEC   P +C    C N  G +EC+CP G++ N  ++ C+DID
Sbjct  186  CKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDID  245

Query  112  ECSIIPGICEGSECSNTVGSYFCIC--PRGYVTSTDGSRC  149
            ECS    +C    C N  G Y C C   +G+  + D   C
Sbjct  246  ECS--ENMC-AQLCVNYPGGYTCYCDGKKGFKLAQDQKSC  282


 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 59/120 (49%), Gaps = 16/120 (13%)

Query  377  CKNGRCVNTDGSFQCICNAGFELTTDGKNC-VDHDECTTTNMCLNG----MCINEDGSFK  431
            CK+G+      SF C C  G++    G+ C  D +EC   +  +NG    +C N  GS+ 
Sbjct  134  CKDGK-----ASFTCTCKPGWQ----GEKCEFDINECKDPS-NINGGCSQICDNTPGSYH  183

Query  432  CICKPGFVLAPNGRYCTDIDECQTS-GICMNGHCINTEGSFRCECPPGLAVGVDGRVCVD  490
            C CK GFV+  N + C D+DEC     IC    C N  G F CECP G    +  + C D
Sbjct  184  CSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCED  243


 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 52/84 (62%), Gaps = 5/84 (6%)

Query  863  KDINECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTC  922
            KD++EC + P +C    C+N  G F+C+C  G+  +++ ++C DIDEC  S ++C    C
Sbjct  200  KDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDEC--SENMCAQ-LC  256

Query  923  VNTPGSFECECFDGYESGFMMMKN  946
            VN PG + C C DG + GF + ++
Sbjct  257  VNYPGGYTCYC-DG-KKGFKLAQD  278


 Score = 56.6 bits (135),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 61/120 (51%), Gaps = 16/120 (13%)

Query  1776  CRNGRCFNEIGSFKCLCNEGYELTLDGKNC-IDTNECVA---LPGSCSPGTCQNLEGSFR  1831
             C++G+      SF C C  G++    G+ C  D NEC     + G CS   C N  GS+ 
Sbjct  134   CKDGK-----ASFTCTCKPGWQ----GEKCEFDINECKDPSNINGGCSQ-ICDNTPGSYH  183

Query  1832  CICPPGYEVKS--ESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFD  1889
             C C  G+ + S  + C D++EC+  P+IC    C N PG F+C CP G+  +   + C D
Sbjct  184   CSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCED  243


 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 4/89 (4%)

Query  1441  DIDECQELPGLCQGG---NCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPG  1497
             DI+EC++ P    GG    C NT GS+ C C  G+ +    + C+D+DEC   P +CG  
Sbjct  157   DINECKD-PSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTA  215

Query  1498  TCYNTLGNYTCICPPEYMQVNGGHNCMDM  1526
              C N  G++ C CP  Y       +C D+
Sbjct  216   VCKNIPGDFECECPEGYRYNLKSKSCEDI  244


 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 54/109 (50%), Gaps = 9/109 (8%)

Query  1261  GAYRCECEMGFTPASDSKSCQ-DINECSFQNICVFG---TCNNLPGMFHCICDDGYELDR  1316
              ++ C C+    P    + C+ DINEC   +    G    C+N PG +HC C +G+ +  
Sbjct  139   ASFTCTCK----PGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLS  194

Query  1317  TGGNCTDVDECA-DPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVD  1364
                +C DVDEC+  P  C   +C N PG +EC CP  ++ N     C D
Sbjct  195   NKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCED  243


 Score = 55.8 bits (133),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 41/71 (58%), Gaps = 3/71 (4%)

Query  1440  EDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTC  1499
             +D+DEC   P +C    C N  G F+CECP+GY  + +++ CEDIDEC     +C    C
Sbjct  200   KDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDEC--SENMCAQ-LC  256

Query  1500  YNTLGNYTCIC  1510
              N  G YTC C
Sbjct  257   VNYPGGYTCYC  267


 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 62/138 (45%), Gaps = 16/138 (12%)

Query  67   DVDECQAIPGVCQGG---NCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICEGS  123
            D++EC+  P    GG    C NT GSY C C  G       + C D+DECS+ P IC  +
Sbjct  157  DINECKD-PSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTA  215

Query  124  ECSNTVGSYFCICPRGYVTSTDGSRCIDQRASTCFSNIVNGRCAQ---ELPGRFTKRQCC  180
             C N  G + C CP GY  +     C D     C  N+    CAQ     PG +T   C 
Sbjct  216  VCKNIPGDFECECPEGYRYNLKSKSCED--IDECSENM----CAQLCVNYPGGYT---CY  266

Query  181  CESGRCWAMGSVPEMCPV  198
            C+  + + +    + C V
Sbjct  267  CDGKKGFKLAQDQKSCEV  284


 Score = 50.1 bits (118),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query  1961  EDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGNGTCT  2020
             +DV+EC   P +C    C N  G F CECP GY  +     C D DECS  N C    C 
Sbjct  200   KDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDECS-ENMCAQ-LCV  257

Query  2021  NVIGSFECNC--HEGFE  2035
             N  G + C C   +GF+
Sbjct  258   NYPGGYTCYCDGKKGFK  274


 Score = 49.7 bits (117),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query  1962  DVNECLESPGV---CSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIG-NPCGNG  2017
             D+NEC +   +   CS   C NT GS+ C C  G+ +      C D DECS+  + CG  
Sbjct  157   DINECKDPSNINGGCSQ-ICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTA  215

Query  2018  TCTNVIGSFECNCHEGF  2034
              C N+ G FEC C EG+
Sbjct  216   VCKNIPGDFECECPEGY  232


> sp|P01133|EGF_HUMAN Pro-epidermal growth factor OS=Homo sapiens 
GN=EGF PE=1 SV=2
Length=1207

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 102/214 (48%), Gaps = 11/214 (5%)

Query  1035  DECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADID--ECESNPDICDGGQCT-  1091
             D C+  NGGC   C    G+  CSC +G+    D +TC  +D  +  +  ++    Q T 
Sbjct  743   DPCLYQNGGCEHICKKRLGTAWCSCREGFMKASDGKTCLALDGHQLLAGGEVDLKNQVTP  802

Query  1092  -NIPGEYRCLCYDGFMASMDMKTC-IDVNECDLNSNI--CMFGECENTKGSFICHCQLGY  1147
              +I  + R +  D    S  M    I V++ D  + +   M+  C +      C C  G+
Sbjct  803   LDILSKTR-VSEDNITESQHMLVAEIMVSDQDDCAPVGCSMYARCISEGEDATCQCLKGF  861

Query  1148  SVKKGTTGCTDVDECEIGAHNCDMHAS-CVNVPGSFKCSCREGWVGNGIKCIDLDECSNG  1206
             +       C+D+DECE+G   C   +S C+N  G + C C EG+ G+GI C+D+DEC  G
Sbjct  862   AGDGKL--CSDIDECEMGVPVCPPASSKCINTEGGYVCRCSEGYQGDGIHCLDIDECQLG  919

Query  1207  THQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSD  1240
              H C  NA C N+ G Y C C    +  G  C D
Sbjct  920   EHSCGENASCTNTEGGYTCMCAGRLSEPGLICPD  953


 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 160/676 (24%), Positives = 256/676 (38%), Gaps = 110/676 (16%)

Query  546   LCSSGIGITVDGR---DINECALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDI  602
             +C+ G  ++ D +   D+NECA     C+ G C+N  GSY C C  G+   P G+ C  +
Sbjct  340   MCAEGYALSRDRKYCEDVNECAFWNHGCTLG-CKNTPGSYYCTCPVGFVLLPDGKRCHQL  398

Query  603   DECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINECESSPCVNGACRNNLG  662
               C  N   C +     + G   C CP+G V   +  TC   +  ++  C       +  
Sbjct  399   VSCPRNVSECSHDCVLTSEGPL-CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCVPLSPV  457

Query  663   SFNCECSPGSKLDSTGLICIDS--LKGTCWLNIQDSRCEVNINGA---TLKSECCATLGA  717
             S+ C+C PG  L      C  S       + N QD R  ++ +G    TL S+    + A
Sbjct  458   SWECDCFPGYDLQLDEKSCAASGPQPFLLFANSQDIR-HMHFDGTDYGTLLSQQMGMVYA  516

Query  718   AWGSPCE-RCELDTACSRGFARVN--GVTCEDVNECDVFPGVCPNGRCINSRGSFHCECP  774
                 P E +        +   R N  G   E + E  V                   + P
Sbjct  517   LDHDPVENKIYFAHTALKWIERANMDGSQRERLIEEGV-------------------DVP  557

Query  775   EGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGKFRMDACCCAVGAAWGSDCEECPKP  834
             EGL +D  GR        + Y T    +  +S+ G+  ++          G   +   K 
Sbjct  558   EGLAVDWIGR--------RFYWT----DRGKSLIGRSDLN----------GKRSKIITKE  595

Query  835   DTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCMNGKCRNTIGSFKCKCNSG  894
             +  +     PRG         +  R F+ D           + G  R  I S      SG
Sbjct  596   NISQ-----PRGIAVHP----MAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSG  646

Query  895   FTLDM--EERNCTDIDECWIS-PDLCGSG----TCVNTPGSFECECFDGY-ESGFMMMKN  946
              T+D   ++    D  +  I   +L GS     T  +    F    F+ Y       M +
Sbjct  647   ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPS  706

Query  947   CMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDS-LCRNG  1005
              M +++         G   V  +GS          L PS    +       +D  L +NG
Sbjct  707   VMRVNKRT-------GKDRVRLQGSM---------LKPSSLVVVHPLAKPGADPCLYQNG  750

Query  1006  KCVNM----VGTYQCSCNSGYQATPDRRSCTDIDECMIMNGG--------CHTHCTNSEG  1053
              C ++    +GT  CSC  G+    D ++C  +D   ++ GG              +   
Sbjct  751   GCEHICKKRLGTAWCSCREGFMKASDGKTCLALDGHQLLAGGEVDLKNQVTPLDILSKTR  810

Query  1054  SYECSCSDGYALMPDVRTCADIDECESNPDICDG-GQCTNIPGEYRCLCYDGFMASMDMK  1112
               E + ++   ++      +D D+C   P  C    +C +   +  C C  GF    D K
Sbjct  811   VSEDNITESQHMLVAEIMVSDQDDCA--PVGCSMYARCISEGEDATCQCLKGFAG--DGK  866

Query  1113  TCIDVNECDLNSNIC--MFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCD  1170
              C D++EC++   +C     +C NT+G ++C C  GY  +     C D+DEC++G H+C 
Sbjct  867   LCSDIDECEMGVPVCPPASSKCINTEGGYVCRCSEGY--QGDGIHCLDIDECQLGEHSCG  924

Query  1171  MHASCVNVPGSFKCSC  1186
              +ASC N  G + C C
Sbjct  925   ENASCTNTEGGYTCMC  940


 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 56/120 (47%), Gaps = 1/120 (1%)

Query  995   CSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGS  1054
             C L    C +  C   + ++ C C  GY  + DR+ C D++EC   N GC   C N+ GS
Sbjct  318   CKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNECAFWNHGCTLGCKNTPGS  377

Query  1055  YECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTC  1114
             Y C+C  G+ L+PD + C  +  C  N   C    C        C C +G +   D KTC
Sbjct  378   YYCTCPVGFVLLPDGKRCHQLVSCPRNVSEC-SHDCVLTSEGPLCFCPEGSVLERDGKTC  436


 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 92/221 (42%), Gaps = 25/221 (11%)

Query  1120  CDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVP  1179
             C L    C    C     S +C C  GY++ +    C DV+EC    H C +   C N P
Sbjct  318   CKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNECAFWNHGCTL--GCKNTP  375

Query  1180  GSFKCSCREGWV--GNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEG--FTGDG  1235
             GS+ C+C  G+V   +G +C  L  C     +CS +  CV +    LC C EG     DG
Sbjct  376   GSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHD--CVLTSEGPLCFCPEGSVLERDG  433

Query  1236  FTCSDVDECAENVHLCENGQCLNV-----PGAYRCECEMGFTPASDSKSCQDINECSFQN  1290
              TCS    C+      +NG C  +     P ++ C+C  G+    D KSC        Q 
Sbjct  434   KTCSG---CSSP----DNGGCSQLCVPLSPVSWECDCFPGYDLQLDEKSCA---ASGPQP  483

Query  1291  ICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDECADPI  1331
               +F    ++  M     D G  L +  G    +D   DP+
Sbjct  484   FLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDH--DPV  522


 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 64/214 (30%), Positives = 91/214 (43%), Gaps = 28/214 (13%)

Query  1694  CSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPG  1753
             C H +C    G+  C C  GF  + D   C+ +D  +    G    KN V   + L    
Sbjct  752   CEH-ICKKRLGTAWCSCREGFMKASDGKTCLALDGHQLLAGGEVDLKNQVTPLDILSKTR  810

Query  1754  FE---LTHNNDCM-------DIDECS----SFFGQVCRNGRCFNEIGSFKCLCNEGYELT  1799
                  +T +   +       D D+C+    S +       RC +E     C C +G+   
Sbjct  811   VSEDNITESQHMLVAEIMVSDQDDCAPVGCSMYA------RCISEGEDATCQCLKGF--A  862

Query  1800  LDGKNCIDTNECVALPGSCSPGT--CQNLEGSFRCICPPGYEVKSESCIDINECNEDPNI  1857
              DGK C D +EC      C P +  C N EG + C C  GY+     C+DI+EC    + 
Sbjct  863   GDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCSEGYQGDGIHCLDIDECQLGEHS  922

Query  1858  C-LFGSCTNTPGGFQCICPTGFVLSDNGRRCFDT  1890
             C    SCTNT GG+ C+C     LS+ G  C D+
Sbjct  923   CGENASCTNTEGGYTCMCAGR--LSEPGLICPDS  954


 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 83/190 (44%), Gaps = 13/190 (7%)

Query  880   CRNTIGSFKCKCNSGFTLDMEERNCTDIDECWI----SPDLCGSGTCVNTPGSFECECFD  935
             C+  +G+  C C  GF    + + C  +D   +      DL    T ++          +
Sbjct  756   CKKRLGTAWCSCREGFMKASDGKTCLALDGHQLLAGGEVDLKNQVTPLDILSKTRVSEDN  815

Query  936   GYESGFMMMKNCMDIDECERNPLLCRG-GTCVNTEGSFQCDCPLGHELSPSREECIDVNE  994
               ES  M++   M  D+ +  P+ C     C++      C C  G   +   + C D++E
Sbjct  816   ITESQHMLVAEIMVSDQDDCAPVGCSMYARCISEGEDATCQCLKG--FAGDGKLCSDIDE  873

Query  995   CSLSDSLC--RNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGC--HTHCTN  1050
             C +   +C   + KC+N  G Y C C+ GYQ   D   C DIDEC +    C  +  CTN
Sbjct  874   CEMGVPVCPPASSKCINTEGGYVCRCSEGYQG--DGIHCLDIDECQLGEHSCGENASCTN  931

Query  1051  SEGSYECSCS  1060
             +EG Y C C+
Sbjct  932   TEGGYTCMCA  941


 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 56/114 (49%), Gaps = 4/114 (4%)

Query  1776  CRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICP  1835
             C +  C  ++ S  C+C EGY L+ D K C D NEC      C+ G C+N  GS+ C CP
Sbjct  325   CSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNECAFWNHGCTLG-CKNTPGSYYCTCP  383

Query  1836  PGYEV--KSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRC  1887
              G+ +    + C  +  C  + + C    C  T  G  C CP G VL  +G+ C
Sbjct  384   VGFVLLPDGKRCHQLVSCPRNVSECSH-DCVLTSEGPLCFCPEGSVLERDGKTC  436


 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 70/155 (45%), Gaps = 4/155 (3%)

Query  1603  CKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSP  1662
             CK   G C++ VC   + S  C C  G++ +     CED++EC+  ++ C     C N+P
Sbjct  318   CKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNECAFWNHGC--TLGCKNTP  375

Query  1663  GSYRCECAAGFKLSPNGA-CVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQT  1721
             GSY C C  GF L P+G  C     C    + CSH   +  +G   C C  G    +D  
Sbjct  376   GSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPL-CFCPEGSVLERDGK  434

Query  1722  MCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFEL  1756
              C      +   C       +  S+ C C+PG++L
Sbjct  435   TCSGCSSPDNGGCSQLCVPLSPVSWECDCFPGYDL  469


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 75/173 (43%), Gaps = 21/173 (12%)

Query  868   CKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPG  927
             CK+  G C +  C   + S  C C  G+ L  + + C D++EC      C  G C NTPG
Sbjct  318   CKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNECAFWNHGCTLG-CKNTPG  376

Query  928   SFECECFDGYESGFMMM---KNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSP  984
             S+ C C      GF+++   K C  +  C RN   C     + +EG   C CP G  L  
Sbjct  377   SYYCTC----PVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPL-CFCPEGSVLER  431

Query  985   SREECIDVNECSLSDSLCRNGKCVNM-----VGTYQCSCNSGYQATPDRRSCT  1032
               + C   + CS  D    NG C  +       +++C C  GY    D +SC 
Sbjct  432   DGKTC---SGCSSPD----NGGCSQLCVPLSPVSWECDCFPGYDLQLDEKSCA  477


 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 77/169 (46%), Gaps = 16/169 (9%)

Query  288  ICKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNGD-CTDVDECT--SNPCSNGDCVNTP  344
            +CK     C +  C   L S+ C C  GY    +   C DV+EC   ++ C+ G C NTP
Sbjct  317  LCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNECAFWNHGCTLG-CKNTP  375

Query  345  GSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGK  404
            GSYYC C  GF   P  + C  +  C +N   C +  CV T     C C  G  L  DGK
Sbjct  376  GSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHD-CVLTSEGPLCFCPEGSVLERDGK  434

Query  405  NCV-----DHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCT  448
             C      D+  C+   + L+ +      S++C C PG+ L  + + C 
Sbjct  435  TCSGCSSPDNGGCSQLCVPLSPV------SWECDCFPGYDLQLDEKSCA  477


 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 48/101 (48%), Gaps = 0/101 (0%)

Query  388  SFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYC  447
            S  C+C  G+ L+ D K C D +EC   N      C N  GS+ C C  GFVL P+G+ C
Sbjct  336  SHLCMCAEGYALSRDRKYCEDVNECAFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRC  395

Query  448  TDIDECQTSGICMNGHCINTEGSFRCECPPGLAVGVDGRVC  488
              +  C  +    +  C+ T     C CP G  +  DG+ C
Sbjct  396  HQLVSCPRNVSECSHDCVLTSEGPLCFCPEGSVLERDGKTC  436


 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 8/102 (8%)

Query  297  LNGRCIPTLSSYRCECNMGYKQDSNGDCTDVDECTSN----PCSNGDCVNTPGSYYCKCH  352
            +  RCI       C+C  G+  D    C+D+DEC       P ++  C+NT G Y C+C 
Sbjct  842  MYARCISEGEDATCQCLKGFAGDGKL-CSDIDECEMGVPVCPPASSKCINTEGGYVCRCS  900

Query  353  AGFQRTPTKQACIDIDECIQNGVLC-KNGRCVNTDGSFQCIC  393
             G+Q       C+DIDEC      C +N  C NT+G + C+C
Sbjct  901  EGYQGDGIH--CLDIDECQLGEHSCGENASCTNTEGGYTCMC  940


 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 55/121 (45%), Gaps = 4/121 (3%)

Query  563  CALDPDICSNGICENLRGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLCRNTPG  622
            C L    CS+ +C     S+ C C  GY      + C D++EC+     C  G C+NTPG
Sbjct  318  CKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNECAFWNHGCTLG-CKNTPG  376

Query  623  SYSCTCPKGYVFSTETDTCEDINECES--SPCVNGACRNNLGSFNCECSPGSKLDSTGLI  680
            SY CTCP G+V   +   C  +  C    S C +     + G   C C  GS L+  G  
Sbjct  377  SYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPL-CFCPEGSVLERDGKT  435

Query  681  C  681
            C
Sbjct  436  C  436


 Score = 53.1 bits (126),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 7/81 (9%)

Query  1962  DVNECLESPGVC--SNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIG-NPCG-NG  2017
             D++EC     VC  ++  CINT+G + C C  GY  D  G+HC+D DEC +G + CG N 
Sbjct  870   DIDECEMGVPVCPPASSKCINTEGGYVCRCSEGYQGD--GIHCLDIDECQLGEHSCGENA  927

Query  2018  TCTNVIGSFECNCHEGF-EPG  2037
             +CTN  G + C C     EPG
Sbjct  928   SCTNTEGGYTCMCAGRLSEPG  948


 Score = 52.8 bits (125),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 41/79 (52%), Gaps = 3/79 (4%)

Query  1811  CVALPGSCSPGTCQNLEGSFRCICPPGYEVKSES--CIDINECNEDPNICLFGSCTNTPG  1868
             C    G+CS   C     S  C+C  GY +  +   C D+NEC    + C  G C NTPG
Sbjct  318   CKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNECAFWNHGCTLG-CKNTPG  376

Query  1869  GFQCICPTGFVLSDNGRRC  1887
              + C CP GFVL  +G+RC
Sbjct  377   SYYCTCPVGFVLLPDGKRC  395


 Score = 50.1 bits (118),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 58/119 (49%), Gaps = 10/119 (8%)

Query  1637  LVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVC--  1694
             ++  D D+C+     C   A CI+      C+C  GF       C D +EC     VC  
Sbjct  827   IMVSDQDDCAPVG--CSMYARCISEGEDATCQCLKGFA-GDGKLCSDIDECEMGVPVCPP  883

Query  1695  SHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECE--RHPCG-NGTCKNTVGSYNCLC  1750
             +   C++ +G Y C C  G++   D   C+D+DEC+   H CG N +C NT G Y C+C
Sbjct  884   ASSKCINTEGGYVCRCSEGYQG--DGIHCLDIDECQLGEHSCGENASCTNTEGGYTCMC  940


> sp|O60494|CUBN_HUMAN Cubilin OS=Homo sapiens GN=CUBN PE=1 SV=5
Length=3623

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 138/476 (29%), Positives = 201/476 (42%), Gaps = 110/476 (23%)

Query  897   LDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFD------GYESGFMMMKNCMDI  950
             L   ++N  DI E          G+ +  P +   + +         E  F  ++  +D 
Sbjct  82    LHQIQKNKEDIIEL--------KGSAIGLPQNISSQIYQLNSKLVDLERKFQGLQQTVDK  133

Query  951   DECERNPLLCR-GGTCVNTEGSFQCDCPLGHELSPSREECI---DVNECSLSDSLCRNGK  1006
               C  NP  C+ GGTC+N   SF C CP      P  +  +   DVNEC +         
Sbjct  134   KVCSSNP--CQNGGTCLNLHDSFFCICP------PQWKGPLCSADVNECEI---------  176

Query  1007  CVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALM  1066
                            Y  TP   SC         NGG    C N+ GSY C C       
Sbjct  177   ---------------YSGTP--LSC--------QNGGT---CVNTMGSYSCHCP------  202

Query  1067  PDVRTCADIDECESNPDICDGGQ--------CTNIPGE------YRCLCYDGFMASMDMK  1112
             P+        +C S  D C+GG         C ++  E      Y C+C  G+M S +  
Sbjct  203   PETYG----PQCASKYDDCEGGSVARCVHGICEDLMREQAGEPKYSCVCDAGWMFSPNSP  258

Query  1113  TC-IDVNECDLNSNIC-MFGECENTKGSFIC-HCQLGYSVKKGTTGCTDVDECEIGAHNC  1169
              C +D +EC      C    +C NT+GSF C  C  G+  +     C D++ECEI    C
Sbjct  259   ACTLDRDECSFQPGPCSTLVQCFNTQGSFYCGACPTGW--QGNGYICEDINECEINNGGC  316

Query  1170  DMH--ASCVNVPGSFKC-SCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSY-LC  1225
              +     CVN PGS  C +C  G+ G+G  C   D CS     C  +A C ++ GS  LC
Sbjct  317   SVAPPVECVNTPGSSHCQACPPGYQGDGRVCTLTDICSVSNGGCHPDASCSSTLGSLPLC  376

Query  1226  ACVEGFTGDGFTCSDVDECAENV---HLCENGQCLNVPGAYRCECEMGFTPASDSKSCQD  1282
              C+ G+TG+G+  +   + + N+   H C NGQC++    Y C+C+ G+T  +     ++
Sbjct  377   TCLPGYTGNGYGPNGCVQLS-NICLSHPCLNGQCIDTVSGYFCKCDSGWTGVN---CTEN  432

Query  1283  INECSFQNICVF-GTCNNLPGMFHCICDDGYELDRTGGNCTDVDE-CADPINCVNG  1336
             INEC   N C+  GTC +    F C C   +    TG  C    + C + ++ +NG
Sbjct  433   INEC-LSNPCLNGGTCVDGVDSFSCECTRLW----TGALCQVPQQVCGESLSGING  483


 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 114/358 (32%), Positives = 160/358 (45%), Gaps = 68/358 (19%)

Query  1697  GLCVDMQGSYKCICHNGFKASQDQTMC-MDVDECERHP-----CGNG-TCKNTVGSYNCL  1749
             G C+++  S+ CIC   +K      +C  DV+ECE +      C NG TC NT+GSY+C 
Sbjct  145   GTCLNLHDSFFCICPPQWKGP----LCSADVNECEIYSGTPLSCQNGGTCVNTMGSYSCH  200

Query  1750  CYPGFELTHNNDCM-DIDECSSFFGQVCRNGRCFNEIG------SFKCLCNEGYELTLDG  1802
             C P    T+   C    D+C       C +G C + +        + C+C+ G+  + + 
Sbjct  201   CPPE---TYGPQCASKYDDCEGGSVARCVHGICEDLMREQAGEPKYSCVCDAGWMFSPNS  257

Query  1803  KNC-IDTNECVALPGSCSPGT-CQNLEGSFRC-ICPPGYEVKSESCIDINECNEDPNICL  1859
               C +D +EC   PG CS    C N +GSF C  CP G++     C DINEC  +   C 
Sbjct  258   PACTLDRDECSFQPGPCSTLVQCFNTQGSFYCGACPTGWQGNGYICEDINECEINNGGCS  317

Query  1860  FG---SCTNTPGGFQC-ICPTGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAF--NTT  1913
                   C NTPG   C  CP G+    +GR C  T    C  +  NG C  P A   +T 
Sbjct  318   VAPPVECVNTPGSSHCQACPPGY--QGDGRVC--TLTDIC--SVSNGGCH-PDASCSSTL  370

Query  1914  KAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVC  1973
              +   C+ +PG                        G+G  P  +   +  N CL  P  C
Sbjct  371   GSLPLCTCLPGYT----------------------GNGYGP--NGCVQLSNICLSHP--C  404

Query  1974  SNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGNG-TCTNVIGSFECNC  2030
              NG CI+T   + C+C  G+    TGV+C +     + NPC NG TC + + SF C C
Sbjct  405   LNGQCIDTVSGYFCKCDSGW----TGVNCTENINECLSNPCLNGGTCVDGVDSFSCEC  458


 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 111/360 (31%), Positives = 153/360 (43%), Gaps = 58/360 (16%)

Query  1454  GGNCINTFGSFQCECPKGYYLSEETRICE-DIDECVAHPGV----CGPGTCYNTLGNYTC  1508
             GG C+N   SF C CP  +    +  +C  D++EC  + G        GTC NT+G+Y+C
Sbjct  144   GGTCLNLHDSFFCICPPQW----KGPLCSADVNECEIYSGTPLSCQNGGTCVNTMGSYSC  199

Query  1509  ICPPEYMQVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCE  1568
              CPPE                       G  C        +K   C   +V +  +  CE
Sbjct  200   HCPPETY---------------------GPQC-------ASKYDDCEGGSVARCVHGICE  231

Query  1569  PCPTPGTAEFKNICGNIPGFTFDIHSGK-AVDIDECKEIPGICANGV-CINQIGSFRC-E  1625
                     E K  C    G+ F  +S    +D DEC   PG C+  V C N  GSF C  
Sbjct  232   DLMREQAGEPKYSCVCDAGWMFSPNSPACTLDRDECSFQPGPCSTLVQCFNTQGSFYCGA  291

Query  1626  CPTGFSYNDLLLVCEDIDEC--SNGDNLCQRNADCINSPGSYRCE-CAAGFKLSPNGACV  1682
             CPTG+  N    +CEDI+EC  +NG        +C+N+PGS  C+ C  G++   +G   
Sbjct  292   CPTGWQGNG--YICEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQ--GDGRVC  347

Query  1683  DRNECLEIPNVCSH--GLCVDMQGSYK-CICHNGFKAS-QDQTMCMDVDE-CERHPCGNG  1737
                +   + N   H    C    GS   C C  G+  +      C+ +   C  HPC NG
Sbjct  348   TLTDICSVSNGGCHPDASCSSTLGSLPLCTCLPGYTGNGYGPNGCVQLSNICLSHPCLNG  407

Query  1738  TCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSFFGQVCRN-GRCFNEIGSFKCLCNEGY  1796
              C +TV  Y C C  G+  T  N   +I+EC S     C N G C + + SF C C   +
Sbjct  408   QCIDTVSGYFCKCDSGW--TGVNCTENINECLS---NPCLNGGTCVDGVDSFSCECTRLW  462


 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 124/424 (29%), Positives = 178/424 (42%), Gaps = 92/424 (22%)

Query  535  CPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICSN------GICENLRGSYRCNCNS  588
             P   S++ + L S  + +    + + +  +D  +CS+      G C NL  S+ C C  
Sbjct  102  LPQNISSQIYQLNSKLVDLERKFQGLQQ-TVDKKVCSSNPCQNGGTCLNLHDSFFCIC--  158

Query  589  GYEPDPSGRNC-VDIDECSVNR---LLCDNG-LCRNTPGSYSCTCP---KGYVFSTETDT  640
               P   G  C  D++EC +     L C NG  C NT GSYSC CP    G   +++ D 
Sbjct  159  --PPQWKGPLCSADVNECEIYSGTPLSCQNGGTCVNTMGSYSCHCPPETYGPQCASKYDD  216

Query  641  CEDINECESSPCVNGACRNNLG------SFNCECSPGSKLDSTGLICIDSLKGTCWLNIQ  694
            CE  +      CV+G C + +        ++C C  G         C           + 
Sbjct  217  CEGGSVAR---CVHGICEDLMREQAGEPKYSCVCDAGWMFSPNSPAC----------TLD  263

Query  695  DSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVNGVTCEDVNECDVFP  754
               C       +   +C  T G+ +           AC  G+ + NG  CED+NEC++  
Sbjct  264  RDECSFQPGPCSTLVQCFNTQGSFYCG---------ACPTGW-QGNGYICEDINECEINN  313

Query  755  G---VCPNGRCINSRGSFHCE-CPEGLTLDGTGRVCLDIRMEQCYLTWDEDECIRSVPGK  810
            G   V P   C+N+ GS HC+ CP G    G GRVC         LT   D C  S  G 
Sbjct  314  GGCSVAPPVECVNTPGSSHCQACPPGY--QGDGRVCT--------LT---DICSVSNGGC  360

Query  811  FRMDACCCAVGAAWGSDCEECPKPDTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKV  870
                +C   +G+                   LC   PG++  G    G     +I  C  
Sbjct  361  HPDASCSSTLGSL-----------------PLCTCLPGYTGNGYGPNGCVQLSNI--CLS  401

Query  871  FPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTD-IDECWISPDLCGSGTCVNTPGSF  929
             P  C+NG+C +T+  + CKC+SG+T      NCT+ I+EC  +P L G GTCV+   SF
Sbjct  402  HP--CLNGQCIDTVSGYFCKCDSGWT----GVNCTENINECLSNPCLNG-GTCVDGVDSF  454

Query  930  ECEC  933
             CEC
Sbjct  455  SCEC  458


 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 99/330 (30%), Positives = 142/330 (43%), Gaps = 63/330 (19%)

Query  361  KQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLN  420
            K + I + + I + +   N + V+ +  FQ     G + T D K C       ++N C N
Sbjct  96   KGSAIGLPQNISSQIYQLNSKLVDLERKFQ-----GLQQTVDKKVC-------SSNPCQN  143

Query  421  G-MCINEDGSFKCICKPGFVLAPNGRYCT-DIDECQ----TSGICMNG-HCINTEGSFRC  473
            G  C+N   SF CIC P +     G  C+ D++EC+    T   C NG  C+NT GS+ C
Sbjct  144  GGTCLNLHDSFFCICPPQW----KGPLCSADVNECEIYSGTPLSCQNGGTCVNTMGSYSC  199

Query  474  ECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCH  533
             CPP       G  C   +    C GG     CV      + + +          GEP +
Sbjct  200  HCPPETY----GPQCASKY--DDCEGG-SVARCVHGICEDLMREQA---------GEPKY  243

Query  534  PCPAKNSAEFHGLCSSGIGITVDG----RDINECALDPDICSNGI-CENLRGSYRCN-CN  587
             C          +C +G   + +      D +EC+  P  CS  + C N +GS+ C  C 
Sbjct  244  SC----------VCDAGWMFSPNSPACTLDRDECSFQPGPCSTLVQCFNTQGSFYCGACP  293

Query  588  SGYEPDPSGRNCVDIDECSVNRLLCDNG---LCRNTPGSYSC-TCPKGYVFSTETDTCED  643
            +G++ +  G  C DI+EC +N   C       C NTPGS  C  CP GY       T  D
Sbjct  294  TGWQGN--GYICEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQGDGRVCTLTD  351

Query  644  INECESSPC-VNGACRNNLGSFN-CECSPG  671
            I    +  C  + +C + LGS   C C PG
Sbjct  352  ICSVSNGGCHPDASCSSTLGSLPLCTCLPG  381


 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 117/386 (30%), Positives = 163/386 (42%), Gaps = 83/386 (22%)

Query  282  LNQTID--ICKHHPDLCLNG-RCIPTLSSYRCECNMGYKQDSNGDC--TDVDEC-----T  331
            L QT+D  +C  +P  C NG  C+    S+ C C   +K    G     DV+EC     T
Sbjct  127  LQQTVDKKVCSSNP--CQNGGTCLNLHDSFFCICPPQWK----GPLCSADVNECEIYSGT  180

Query  332  SNPCSNG-DCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVL-CKNGRCVNT----  385
               C NG  CVNT GSY C C      T   Q     D+C    V  C +G C +     
Sbjct  181  PLSCQNGGTCVNTMGSYSCHCPP---ETYGPQCASKYDDCEGGSVARCVHGICEDLMREQ  237

Query  386  --DGSFQCICNAGFELTTDGKNC-VDHDECTTTNMCLNGM--CINEDGSFKC-ICKPGFV  439
              +  + C+C+AG+  + +   C +D DEC+      + +  C N  GSF C  C  G+ 
Sbjct  238  AGEPKYSCVCDAGWMFSPNSPACTLDRDECSFQPGPCSTLVQCFNTQGSFYCGACPTGW-  296

Query  440  LAPNGRYCTDIDECQTS----GICMNGHCINTEGSFRCE-CPPGLAVGVDGRVCVDTHMR  494
               NG  C DI+EC+ +     +     C+NT GS  C+ CPPG     DGRVC  T + 
Sbjct  297  -QGNGYICEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQ--GDGRVCTLTDIC  353

Query  495  STCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPA-KNSAEFHGLCSSGIGI  553
            S   GG                               CHP  +  ++     LC+   G 
Sbjct  354  SVSNGG-------------------------------CHPDASCSSTLGSLPLCTCLPGY  382

Query  554  TVDGRDINECALDPDI-----CSNGICENLRGSYRCNCNSGYEPDPSGRNCVD-IDECSV  607
            T +G   N C    +I     C NG C +    Y C C+SG+    +G NC + I+EC  
Sbjct  383  TGNGYGPNGCVQLSNICLSHPCLNGQCIDTVSGYFCKCDSGW----TGVNCTENINECLS  438

Query  608  NRLLCDNGLCRNTPGSYSCTCPKGYV  633
            N  L + G C +   S+SC C + + 
Sbjct  439  NPCL-NGGTCVDGVDSFSCECTRLWT  463


 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 117/401 (29%), Positives = 162/401 (40%), Gaps = 111/401 (28%)

Query  1295  GTCNNLPGMFHCICDDGYELDRTGGNCT-DVDEC----ADPINCVNG-LCVNTPGRYECN  1348
             GTC NL   F CIC   ++    G  C+ DV+EC      P++C NG  CVNT G Y C+
Sbjct  145   GTCLNLHDSFFCICPPQWK----GPLCSADVNECEIYSGTPLSCQNGGTCVNTMGSYSCH  200

Query  1349  CPPDFQLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEI----GVGVSR---SSCCCSL  1401
             CPP+                     YGP+      C ++     G  V+R     C   +
Sbjct  201   CPPE--------------------TYGPQ------CASKYDDCEGGSVARCVHGICEDLM  234

Query  1402  GKAWGNPCETCPPVNSTEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQG-GNCINT  1460
              +  G P  +C          +C  G  F PN     L D DEC   PG C     C NT
Sbjct  235   REQAGEPKYSC----------VCDAGWMFSPNSPACTL-DRDECSFQPGPCSTLVQCFNT  283

Query  1461  FGSFQC-ECPKGYYLSEETRICEDIDECVAHPG---VCGPGTCYNTLGNYTC-ICPPEYM  1515
              GSF C  CP G+       ICEDI+EC  + G   V  P  C NT G+  C  CPP Y 
Sbjct  284   QGSFYCGACPTGW--QGNGYICEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGY-  340

Query  1516  QVNGGHNCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPT-PG  1574
             Q +G                               R+C  T ++    N  C P  +   
Sbjct  341   QGDG-------------------------------RVCTLT-DICSVSNGGCHPDASCSS  368

Query  1575  TAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGI-----CANGVCINQIGSFRCECPTG  1629
             T     +C  +PG+T     G     + C ++  I     C NG CI+ +  + C+C +G
Sbjct  369   TLGSLPLCTCLPGYT-----GNGYGPNGCVQLSNICLSHPCLNGQCIDTVSGYFCKCDSG  423

Query  1630  FSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECA  1670
             ++  +     E+I+EC +  N C     C++   S+ CEC 
Sbjct  424   WTGVN---CTENINECLS--NPCLNGGTCVDGVDSFSCECT  459


> sp|P14543|NID1_HUMAN Nidogen-1 OS=Homo sapiens GN=NID1 PE=1 SV=3
Length=1247

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 69/212 (33%), Positives = 100/212 (47%), Gaps = 21/212 (10%)

Query  1118  NECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDV--DECEIGAHNCDMHASC  1175
              +  ++S   ++ + E      I    L  S+     G  D   + C IG H CD +A+C
Sbjct  631   QQLSVDSVFVLYNQEEK-----ILRYALSNSIGPVREGSPDALQNPCYIGTHGCDTNAAC  685

Query  1176  VNVPGS-FKCSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEG--FT  1232
                P + F C C  G+ G+G  C D+DECS     C  +  C N PG++ C CVEG  F+
Sbjct  686   RPGPRTQFTCECSIGFRGDGRTCYDIDECSEQPSVCGSHTICNNHPGTFRCECVEGYQFS  745

Query  1233  GDGFTCSDVDE-----CAENVHLC---ENGQCLNVPG-AYRCECEMGFTPASDSKSCQDI  1283
              +G   + VD+     C   +H C   +  QC+   G +Y C C  GF  + D ++CQD+
Sbjct  746   DEGTCVAVVDQRPINYCETGLHNCDIPQRAQCIYTGGSSYTCSCLPGF--SGDGQACQDV  803

Query  1284  NECSFQNICVFGTCNNLPGMFHCICDDGYELD  1315
             +EC          C N PG F C C  GY+ D
Sbjct  804   DECQPSRCHPDAFCYNTPGSFTCQCKPGYQGD  835


 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 79/152 (52%), Gaps = 13/152 (9%)

Query  1096  EYRCLCYDGFMASMDMKTCIDVNECDLNSNIC-MFGECENTKGSFICHCQLGYSVKKGTT  1154
             ++ C C  GF    D +TC D++EC    ++C     C N  G+F C C  GY      T
Sbjct  692   QFTCECSIGFRG--DGRTCYDIDECSEQPSVCGSHTICNNHPGTFRCECVEGYQFSDEGT  749

Query  1155  GCTDVDE-----CEIGAHNCDM--HASCVNVPGS-FKCSCREGWVGNGIKCIDLDECSNG  1206
                 VD+     CE G HNCD+   A C+   GS + CSC  G+ G+G  C D+DEC   
Sbjct  750   CVAVVDQRPINYCETGLHNCDIPQRAQCIYTGGSSYTCSCLPGFSGDGQACQDVDECQPS  809

Query  1207  THQCSVNAQCVNSPGSYLCACVEGFTGDGFTC  1238
               +C  +A C N+PGS+ C C  G+ GDGF C
Sbjct  810   --RCHPDAFCYNTPGSFTCQCKPGYQGDGFRC  839


 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 81/166 (49%), Gaps = 18/166 (11%)

Query  1203  CSNGTHQCSVNAQCVNSPGS-YLCACVEGFTGDGFTCSDVDECAENVHLC-ENGQCLNVP  1260
             C  GTH C  NA C   P + + C C  GF GDG TC D+DEC+E   +C  +  C N P
Sbjct  672   CYIGTHGCDTNAACRPGPRTQFTCECSIGFRGDGRTCYDIDECSEQPSVCGSHTICNNHP  731

Query  1261  GAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCN-NLPGMFHCI----------CD  1309
             G +RCEC  G+   SD  +C  + +    N C  G  N ++P    CI          C 
Sbjct  732   GTFRCECVEGYQ-FSDEGTCVAVVDQRPINYCETGLHNCDIPQRAQCIYTGGSSYTCSCL  790

Query  1310  DGYELDRTGGNCTDVDECADPINC-VNGLCVNTPGRYECNCPPDFQ  1354
              G+  D  G  C DVDEC  P  C  +  C NTPG + C C P +Q
Sbjct  791   PGFSGD--GQACQDVDEC-QPSRCHPDAFCYNTPGSFTCQCKPGYQ  833


 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 73/147 (50%), Gaps = 17/147 (12%)

Query  1621  SFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGA  1680
              F CEC  GF  +     C DIDECS   ++C  +  C N PG++RCEC  G++ S  G 
Sbjct  692   QFTCECSIGFRGDGR--TCYDIDECSEQPSVCGSHTICNNHPGTFRCECVEGYQFSDEGT  749

Query  1681  CVDRNECLEIPNVCSHGL----------CVDMQG-SYKCICHNGFKASQDQTMCMDVDEC  1729
             CV   +   I N C  GL          C+   G SY C C  GF  S D   C DVDEC
Sbjct  750   CVAVVDQRPI-NYCETGLHNCDIPQRAQCIYTGGSSYTCSCLPGF--SGDGQACQDVDEC  806

Query  1730  ERHPCG-NGTCKNTVGSYNCLCYPGFE  1755
             +   C  +  C NT GS+ C C PG++
Sbjct  807   QPSRCHPDAFCYNTPGSFTCQCKPGYQ  833


 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 95/220 (43%), Gaps = 36/220 (16%)

Query  329  ECTSNPC--------SNGDCVNTPGSYY-CKCHAGFQRTPTKQACIDIDECIQNGVLC-K  378
            +   NPC        +N  C   P + + C+C  GF+     + C DIDEC +   +C  
Sbjct  666  DALQNPCYIGTHGCDTNAACRPGPRTQFTCECSIGFRGD--GRTCYDIDECSEQPSVCGS  723

Query  379  NGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGM----------CINEDG  428
            +  C N  G+F+C C  G++ + +G  CV   +    N C  G+          CI   G
Sbjct  724  HTICNNHPGTFRCECVEGYQFSDEG-TCVAVVDQRPINYCETGLHNCDIPQRAQCIYTGG  782

Query  429  S-FKCICKPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCECPPGLAVGVDGRV  487
            S + C C PGF  + +G+ C D+DECQ S    +  C NT GSF C+C PG     DG  
Sbjct  783  SSYTCSCLPGF--SGDGQACQDVDECQPSRCHPDAFCYNTPGSFTCQCKPGYQ--GDGFR  838

Query  488  CVD--------THMRSTCYGGIKKGACVRPFPGAVTKSEC  519
            CV          H R    G        RP P  +   EC
Sbjct  839  CVPGEVEKTRCQHEREHILGAAGATDPQRPIPPGLFVPEC  878


 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 77/145 (53%), Gaps = 15/145 (10%)

Query  306  SSYRCECNMGYKQDSNGDCTDVDECTSNPC---SNGDCVNTPGSYYCKCHAGFQRTPTKQ  362
            + + CEC++G++ D    C D+DEC+  P    S+  C N PG++ C+C  G+Q +    
Sbjct  691  TQFTCECSIGFRGDGR-TCYDIDECSEQPSVCGSHTICNNHPGTFRCECVEGYQFSDEGT  749

Query  363  --ACID---IDEC---IQNGVLCKNGRCVNTDG-SFQCICNAGFELTTDGKNCVDHDECT  413
              A +D   I+ C   + N  + +  +C+ T G S+ C C  GF  + DG+ C D DEC 
Sbjct  750  CVAVVDQRPINYCETGLHNCDIPQRAQCIYTGGSSYTCSCLPGF--SGDGQACQDVDECQ  807

Query  414  TTNMCLNGMCINEDGSFKCICKPGF  438
             +    +  C N  GSF C CKPG+
Sbjct  808  PSRCHPDAFCYNTPGSFTCQCKPGY  832


 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 73/148 (49%), Gaps = 16/148 (11%)

Query  886   SFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGT-CVNTPGSFECECFDGY----ESG  940
              F C+C+ GF  D   R C DIDEC   P +CGS T C N PG+F CEC +GY    E  
Sbjct  692   QFTCECSIGFRGD--GRTCYDIDECSEQPSVCGSHTICNNHPGTFRCECVEGYQFSDEGT  749

Query  941   FMMMKNCMDIDECERNPLLC---RGGTCVNTEGS-FQCDCPLGHELSPSREECIDVNECS  996
              + + +   I+ CE     C   +   C+ T GS + C C  G   S   + C DV+EC 
Sbjct  750   CVAVVDQRPINYCETGLHNCDIPQRAQCIYTGGSSYTCSCLPG--FSGDGQACQDVDECQ  807

Query  997   LSDSLCR-NGKCVNMVGTYQCSCNSGYQ  1023
                S C  +  C N  G++ C C  GYQ
Sbjct  808   --PSRCHPDAFCYNTPGSFTCQCKPGYQ  833


 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 85/190 (45%), Gaps = 28/190 (15%)

Query  978   LGHELSPSREECIDV--NECSL------SDSLCRNGKCVNMVGTYQCSCNSGYQATPDRR  1029
             L + + P RE   D   N C +      +++ CR G        + C C+ G++   D R
Sbjct  653   LSNSIGPVREGSPDALQNPCYIGTHGCDTNAACRPGPRTQ----FTCECSIGFRG--DGR  706

Query  1030  SCTDIDECMIMNG--GCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDE-----CES--  1080
             +C DIDEC       G HT C N  G++ C C +GY    +    A +D+     CE+  
Sbjct  707   TCYDIDECSEQPSVCGSHTICNNHPGTFRCECVEGYQFSDEGTCVAVVDQRPINYCETGL  766

Query  1081  -NPDICDGGQCTNIPG-EYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGS  1138
              N DI    QC    G  Y C C  GF  S D + C DV+EC   S       C NT GS
Sbjct  767   HNCDIPQRAQCIYTGGSSYTCSCLPGF--SGDGQACQDVDECQ-PSRCHPDAFCYNTPGS  823

Query  1139  FICHCQLGYS  1148
             F C C+ GY 
Sbjct  824   FTCQCKPGYQ  833


 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 68/146 (47%), Gaps = 15/146 (10%)

Query  928   SFECECFDGYESGFMMMKNCMDIDECERNPLLCRGGT-CVNTEGSFQCDCPLGHELSPS-  985
              F CEC  G+       + C DIDEC   P +C   T C N  G+F+C+C  G++ S   
Sbjct  692   QFTCECSIGFRGD---GRTCYDIDECSEQPSVCGSHTICNNHPGTFRCECVEGYQFSDEG  748

Query  986   ------REECIDVNECSLSD-SLCRNGKCVNMVGT-YQCSCNSGYQATPDRRSCTDIDEC  1037
                    +  I+  E  L +  + +  +C+   G+ Y CSC  G+    D ++C D+DEC
Sbjct  749   TCVAVVDQRPINYCETGLHNCDIPQRAQCIYTGGSSYTCSCLPGFSG--DGQACQDVDEC  806

Query  1038  MIMNGGCHTHCTNSEGSYECSCSDGY  1063
                       C N+ GS+ C C  GY
Sbjct  807   QPSRCHPDAFCYNTPGSFTCQCKPGY  832


 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 71/155 (46%), Gaps = 19/155 (12%)

Query  1705  SYKCICHNGFKASQDQTMCMDVDECERHP--CGNGT-CKNTVGSYNCLCYPGFELTHNND  1761
              + C C  GF+   D   C D+DEC   P  CG+ T C N  G++ C C  G++ +    
Sbjct  692   QFTCECSIGFRG--DGRTCYDIDECSEQPSVCGSHTICNNHPGTFRCECVEGYQFSDEGT  749

Query  1762  CM------DIDECSSFFGQ--VCRNGRCFNEIGS-FKCLCNEGYELTLDGKNCIDTNECV  1812
             C+       I+ C +      + +  +C    GS + C C  G+  + DG+ C D +EC 
Sbjct  750   CVAVVDQRPINYCETGLHNCDIPQRAQCIYTGGSSYTCSCLPGF--SGDGQACQDVDEC-  806

Query  1813  ALPGSCSP-GTCQNLEGSFRCICPPGYEVKSESCI  1846
               P  C P   C N  GSF C C PGY+     C+
Sbjct  807   -QPSRCHPDAFCYNTPGSFTCQCKPGYQGDGFRCV  840


 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 87/179 (49%), Gaps = 35/179 (20%)

Query  614  NGLCRNTPGS-YSCTCPKGYVFSTETDTCEDINECESSPCVNGA---CRNNLGSFNCECS  669
            N  CR  P + ++C C  G  F  +  TC DI+EC   P V G+   C N+ G+F CEC 
Sbjct  682  NAACRPGPRTQFTCECSIG--FRGDGRTCYDIDECSEQPSVCGSHTICNNHPGTFRCECV  739

Query  670  PGSKLDSTGLICIDSLKGTCWLNIQDSR----CEVNINGATL--KSECCATLGAAWGSPC  723
             G +          S +GTC + + D R    CE  ++   +  +++C  T G+++    
Sbjct  740  EGYQF---------SDEGTC-VAVVDQRPINYCETGLHNCDIPQRAQCIYTGGSSY----  785

Query  724  ERCELDTACSRGFARVNGVTCEDVNECDVFPGVC-PNGRCINSRGSFHCECPEGLTLDG  781
                   +C  GF+  +G  C+DV+EC   P  C P+  C N+ GSF C+C  G   DG
Sbjct  786  -----TCSCLPGFSG-DGQACQDVDECQ--PSRCHPDAFCYNTPGSFTCQCKPGYQGDG  836


 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 82/199 (41%), Gaps = 52/199 (26%)

Query  1816  GSCSPGTCQNLEGSFRCICPPGYEVKSESCIDINECNEDPNICLFGS---CTNTPGGFQC  1872
              +C PG        F C C  G+     +C DI+EC+E P++C  GS   C N PG F+C
Sbjct  683   AACRPGP----RTQFTCECSIGFRGDGRTCYDIDECSEQPSVC--GSHTICNNHPGTFRC  736

Query  1873  ICPTGFVLSDNGR--RCFDTRQ-SFCFTNFENGKCSVPKA---FNTTKAKCCCSKMPG-E  1925
              C  G+  SD G      D R  ++C T   N  C +P+      T  +   CS +PG  
Sbjct  737   ECVEGYQFSDEGTCVAVVDQRPINYCETGLHN--CDIPQRAQCIYTGGSSYTCSCLPGFS  794

Query  1926  GWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTREDVNECLESPGVCS-NGHCINTDGS  1984
             G G  C                             +DV+EC   P  C  +  C NT GS
Sbjct  795   GDGQAC-----------------------------QDVDEC--QPSRCHPDAFCYNTPGS  823

Query  1985  FRCECPMGYNLDYTGVHCI  2003
             F C+C  GY  D  G  C+
Sbjct  824   FTCQCKPGYQGD--GFRCV  840


 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 61/155 (39%), Gaps = 55/155 (35%)

Query  579  RGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLC-DNGLCRNTPGSYSCTCPKGYVFSTE  637
            R  + C C+ G+  D  GR C DIDECS    +C  + +C N PG++ C C +GY FS E
Sbjct  690  RTQFTCECSIGFRGD--GRTCYDIDECSEQPSVCGSHTICNNHPGTFRCECVEGYQFSDE  747

Query  638  -------------------------------------------------TDTCEDINECE  648
                                                                C+D++EC+
Sbjct  748  GTCVAVVDQRPINYCETGLHNCDIPQRAQCIYTGGSSYTCSCLPGFSGDGQACQDVDECQ  807

Query  649  SSPCVNGA-CRNNLGSFNCECSPGSKLDSTGLICI  682
             S C   A C N  GSF C+C PG + D  G  C+
Sbjct  808  PSRCHPDAFCYNTPGSFTCQCKPGYQGD--GFRCV  840


> sp|P07204|TRBM_HUMAN Thrombomodulin OS=Homo sapiens GN=THBD PE=1 
SV=2
Length=575

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 112/261 (43%), Gaps = 22/261 (8%)

Query  1621  SFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGA  1680
                C  P G              +CS  +  C+   + I  PG+ RC+C AG  L  +G 
Sbjct  221   QLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAI--PGAPRCQCPAGAALQADGR  278

Query  1681  CVDRNECLEIPNVCSHGLCV---DMQGSYKCICHNGFKASQDQTMCMDVDEC--ERHPCG  1735
                 +      ++C H  CV   D  GSY C+C  G++ + DQ  C DVD+C  E  PC 
Sbjct  279   SCTASATQSCNDLCEH-FCVPNPDQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCP  337

Query  1736  NGTCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEG  1795
                C NT G + C CYP ++L        +D C  F        +  N+  S+ C+C EG
Sbjct  338   Q-RCVNTQGGFECHCYPNYDLVDGECVEPVDPC--FRANCEYQCQPLNQT-SYLCVCAEG  393

Query  1796  YE-LTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSE-SCIDINECNE  1853
             +  +  +   C       A P  C P T         C CP GY +     C DI+EC E
Sbjct  394   FAPIPHEPHRCQMFCNQTACPADCDPNT------QASCECPEGYILDDGFICTDIDEC-E  446

Query  1854  DPNICLFGSCTNTPGGFQCIC  1874
             +   C  G C N PG F+CIC
Sbjct  447   NGGFC-SGVCHNLPGTFECIC  466


 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 82/237 (35%), Positives = 112/237 (47%), Gaps = 19/237 (8%)

Query  1036  ECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTN--I  1093
             +C + NGGC   C    G+  C C  G AL  D R+C      +S  D+C+     N   
Sbjct  244   DCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCT-ASATQSCNDLCEHFCVPNPDQ  302

Query  1094  PGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGT  1153
             PG Y C+C  G+  + D   C DV++C L  + C    C NT+G F CHC   Y +  G 
Sbjct  303   PGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCP-QRCVNTQGGFECHCYPNYDLVDGE  361

Query  1154  TGCTD-VDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSV  1212
               C + VD C     NC+     +N   S+ C C EG+        +   C    +Q + 
Sbjct  362   --CVEPVDPCFRA--NCEYQCQPLNQ-TSYLCVCAEGFAPIP---HEPHRCQMFCNQTAC  413

Query  1213  NAQC-VNSPGSYLCACVEGFT-GDGFTCSDVDECAENVHLCENGQCLNVPGAYRCEC  1267
              A C  N+  S  C C EG+   DGF C+D+DEC EN   C +G C N+PG + C C
Sbjct  414   PADCDPNTQAS--CECPEGYILDDGFICTDIDEC-ENGGFC-SGVCHNLPGTFECIC  466


 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 88/270 (33%), Positives = 113/270 (42%), Gaps = 56/270 (21%)

Query  1252  ENGQCLN----VPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNN--LPGMFH  1305
             ENG C +    +PGA RC+C  G    +D +SC      S  ++C      N   PG + 
Sbjct  248   ENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNPDQPGSYS  307

Query  1306  CICDDGYELDRTGGNCTDVDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDN  1365
             C+C+ GY L      C DVD+C    +     CVNT G +EC+C P++ L       VD 
Sbjct  308   CMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDL-------VD-  359

Query  1366  RVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYNTLCP  1425
               G C     P        N E                        C P+N T Y  LC 
Sbjct  360   --GECVEPVDP----CFRANCEY----------------------QCQPLNQTSY--LCV  389

Query  1426  GGEGFRPNPITIILEDIDECQEL--PGLCQGGNCINTFGSFQCECPKGYYLSEETRICED  1483
               EGF P P      +   CQ       C      NT  S  CECP+GY L ++  IC D
Sbjct  390   CAEGFAPIP-----HEPHRCQMFCNQTACPADCDPNTQAS--CECPEGYIL-DDGFICTD  441

Query  1484  IDECVAHPGVCGPGTCYNTLGNYTCICPPE  1513
             IDEC  + G C  G C+N  G + CIC P+
Sbjct  442   IDEC-ENGGFCS-GVCHNLPGTFECICGPD  469


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 71/230 (31%), Positives = 104/230 (45%), Gaps = 25/230 (11%)

Query  964   TCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCV---NMVGTYQCSCNS  1020
              C    G+ +C CP G  L      C      S +D LC +  CV   +  G+Y C C +
Sbjct  255   ACNAIPGAPRCQCPAGAALQADGRSCTASATQSCND-LCEH-FCVPNPDQPGSYSCMCET  312

Query  1021  GYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDEC-E  1079
             GY+   D+  C D+D+C++    C   C N++G +EC C   Y L+ D      +D C  
Sbjct  313   GYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLV-DGECVEPVDPCFR  371

Query  1080  SNPDICDGGQCTNI-PGEYRCLCYDGFMASMDMKTCIDVNECDL--NSNICMFGECENTK  1136
             +N +     QC  +    Y C+C +GF          + + C +  N   C      NT+
Sbjct  372   ANCEY----QCQPLNQTSYLCVCAEGFAPIPH-----EPHRCQMFCNQTACPADCDPNTQ  422

Query  1137  GSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSC  1186
              S  C C  GY +  G   CTD+DECE G     +   C N+PG+F+C C
Sbjct  423   AS--CECPEGYILDDGFI-CTDIDECENGGFCSGV---CHNLPGTFECIC  466


 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 95/238 (40%), Gaps = 22/238 (9%)

Query  1090  CTNIPGEYRCLCYDGFMASMDMKTCID--VNEC-DLNSNICMFGECENTKGSFICHCQLG  1146
             C  IPG  RC C  G     D ++C       C DL  + C+     +  GS+ C C+ G
Sbjct  256   CNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNP--DQPGSYSCMCETG  313

Query  1147  YSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIKCID-LDECSN  1205
             Y +      C DVD+C +    C     CVN  G F+C C   +     +C++ +D C  
Sbjct  314   YRLAADQHRCEDVDDCILEPSPCPQR--CVNTQGGFECHCYPNYDLVDGECVEPVDPCFR  371

Query  1206  GTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECAENVHLCENGQCL---NVPGA  1262
                 C    Q +N   SYLC C EGF           E       C    C    +    
Sbjct  372   AN--CEYQCQPLNQ-TSYLCVCAEGFA------PIPHEPHRCQMFCNQTACPADCDPNTQ  422

Query  1263  YRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGN  1320
               CEC  G+    D   C DI+EC     C  G C+NLPG F CIC     L R  G 
Sbjct  423   ASCECPEGYI-LDDGFICTDIDECENGGFCS-GVCHNLPGTFECICGPDSALARHIGT  478


 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 86/199 (43%), Gaps = 36/199 (18%)

Query  885   GSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMM  944
             GS+ C C +G+ L  ++  C D+D+C + P  C    CVNT G FEC C+  Y+   ++ 
Sbjct  304   GSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQ-RCVNTQGGFECHCYPNYD---LVD  359

Query  945   KNCMD-IDECER-------NPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECS  996
               C++ +D C R        PL      CV  EG      P+ HE  P R        C 
Sbjct  360   GECVEPVDPCFRANCEYQCQPLNQTSYLCVCAEGF----APIPHE--PHR--------CQ  405

Query  997   LSDSLCRNGKCV---NMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGG-CHTHCTNSE  1052
             +    C    C    +      C C  GY    D   CTDIDEC   NGG C   C N  
Sbjct  406   M---FCNQTACPADCDPNTQASCECPEGY-ILDDGFICTDIDECE--NGGFCSGVCHNLP  459

Query  1053  GSYECSCSDGYALMPDVRT  1071
             G++EC C    AL   + T
Sbjct  460   GTFECICGPDSALARHIGT  478


 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 76/173 (44%), Gaps = 18/173 (10%)

Query  1462  GSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGH  1521
             GS+ C C  GY L+ +   CED+D+C+  P  C P  C NT G + C C P Y  V+G  
Sbjct  304   GSYSCMCETGYRLAADQHRCEDVDDCILEPSPC-PQRCVNTQGGFECHCYPNYDLVDG--  360

Query  1522  NCMDMRKSFCYRSYNGTSCENELPFNVTKRMCCCTYNVGKAWNKPCE--------PCPTP  1573
              C++     C+R+     C+   P N T  +C C        ++P           CP  
Sbjct  361   ECVEPVDP-CFRANCEYQCQ---PLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPAD  416

Query  1574  GTAEFKNICGNIPGFTFDIHSGKAVDIDECKEIPGICANGVCINQIGSFRCEC  1626
                  +  C    G+  D       DIDEC E  G C +GVC N  G+F C C
Sbjct  417   CDPNTQASCECPEGYILD-DGFICTDIDEC-ENGGFC-SGVCHNLPGTFECIC  466


 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 100/250 (40%), Gaps = 49/250 (20%)

Query  1786  GSFKCLCNEGYELTLDGKNCID--TNECVAL-PGSCSPGTCQNLEGSFRCICPPGYEVKS  1842
             G+ +C C  G  L  DG++C    T  C  L    C P   Q   GS+ C+C  GY + +
Sbjct  261   GAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNPDQ--PGSYSCMCETGYRLAA  318

Query  1843  ES--CIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCFTNFE  1900
             +   C D+++C  +P+ C    C NT GGF+C C   + L D    C +     CF    
Sbjct  319   DQHRCEDVDDCILEPSPCP-QRCVNTQGGFECHCYPNYDLVDG--ECVEPVDP-CFRANC  374

Query  1901  NGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGIDDTR  1960
               +C   +  N T   C C++                           G   IP      
Sbjct  375   EYQC---QPLNQTSYLCVCAE---------------------------GFAPIPHEPHRC  404

Query  1961  EDVNECLESPGVCSNGHCINTDGSFRCECPMGYNLDYTGVHCIDTDECSIGNPCGNGTCT  2020
             +        P  C      NT  S  CECP GY LD  G  C D DEC  G  C +G C 
Sbjct  405   QMFCNQTACPADCDP----NTQAS--CECPEGYILD-DGFICTDIDECENGGFC-SGVCH  456

Query  2021  NVIGSFECNC  2030
             N+ G+FEC C
Sbjct  457   NLPGTFECIC  466


 Score = 52.8 bits (125),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 100/283 (35%), Gaps = 68/283 (24%)

Query  429  SFKCICKPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCECPPGLAVGVDGRVC  488
               C   PG V     R      +C          C    G+ RC+CP G A+  DGR C
Sbjct  221  QLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSC  280

Query  489  VDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCHPCPAKNSAEFHGLCS  548
              +  +S          C             C  NPD                 +  +C 
Sbjct  281  TASATQSC------NDLC----------EHFCVPNPD-------------QPGSYSCMCE  311

Query  549  SGIGITVDGR---DINECALDPDICSNGICENLRGSYRCNCNSGY--------EP-DPSG  596
            +G  +  D     D+++C L+P  C    C N +G + C+C   Y        EP DP  
Sbjct  312  TGYRLAADQHRCEDVDDCILEPSPCPQR-CVNTQGGFECHCYPNYDLVDGECVEPVDPCF  370

Query  597  R-----NCVDIDECSVN-----------------RLLCDNGLCR---NTPGSYSCTCPKG  631
            R      C  +++ S                   ++ C+   C    +     SC CP+G
Sbjct  371  RANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCDPNTQASCECPEG  430

Query  632  YVFSTETDTCEDINECESSPCVNGACRNNLGSFNCECSPGSKL  674
            Y+   +   C DI+ECE+    +G C N  G+F C C P S L
Sbjct  431  YILD-DGFICTDIDECENGGFCSGVCHNLPGTFECICGPDSAL  472


 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 72/184 (39%), Gaps = 50/184 (27%)

Query  1617  NQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLS  1676
             +Q GS+ C C TG+        CED+D+C    + C +   C+N+ G + C C   + L 
Sbjct  301   DQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQR--CVNTQGGFECHCYPNYDL-  357

Query  1677  PNGACVDRNECLEIPNVCSHGLCVDM-----QGSYKCICHNGF-----------------  1714
                  VD  EC+E  + C    C        Q SY C+C  GF                 
Sbjct  358   -----VD-GECVEPVDPCFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQT  411

Query  1715  ----------KAS---------QDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFE  1755
                       +AS          D  +C D+DECE     +G C N  G++ C+C P   
Sbjct  412   ACPADCDPNTQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGPDSA  471

Query  1756  LTHN  1759
             L  +
Sbjct  472   LARH  475


> sp|Q14112|NID2_HUMAN Nidogen-2 OS=Homo sapiens GN=NID2 PE=1 SV=3
Length=1375

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 81/143 (57%), Gaps = 14/143 (10%)

Query  1139  FICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGW--VGNGIK  1196
             + C C  GY  +     C D +EC  G H C  ++ C+N+PGS++C CR G+    +   
Sbjct  784   YTCECASGY--QGDGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRHT  841

Query  1197  CIDL----DECSNGTHQCSV--NAQCVNSPGS-YLCACVEGFTGDGFTCSDVDECAENV-  1248
             CI +    + C +G+H C+    A+CV+  GS + CAC+ G+ GDG  C+DVDEC+EN  
Sbjct  842   CILITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQCTDVDECSENRC  901

Query  1249  HLCENGQCLNVPGAYRCECEMGF  1271
             H      C N PG++ C C+ G+
Sbjct  902   HPA--ATCYNTPGSFSCRCQPGY  922


 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 82/164 (50%), Gaps = 17/164 (10%)

Query  1162  CEIGAHNCDMHASCVNVPGS---FKCSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVN  1218
             C  G+H CD  A C   PG+   + C C  G+ G+G  C+D +EC+ G H+C  N+ C+N
Sbjct  763   CYDGSHMCDTTARCH--PGTGVDYTCECASGYQGDGRNCVDENECATGFHRCGPNSVCIN  820

Query  1219  SPGSYLCACVEG--FTGDGFTCSDV----DECAENVHLCE---NGQCLNVPGA-YRCECE  1268
              PGSY C C  G  F  D  TC  +    + C +  H C      +C++  G+ + C C 
Sbjct  821   LPGSYRCECRSGYEFADDRHTCILITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACL  880

Query  1269  MGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGY  1312
              G+  A D   C D++ECS        TC N PG F C C  GY
Sbjct  881   PGY--AGDGHQCTDVDECSENRCHPAATCYNTPGSFSCRCQPGY  922


 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 76/153 (50%), Gaps = 15/153 (10%)

Query  1055  YECSCSDGYALMPDVRTCADIDECESNPDIC-DGGQCTNIPGEYRCLCYDGFMASMDMKT  1113
             Y C C+ GY    D R C D +EC +    C     C N+PG YRC C  G+  + D  T
Sbjct  784   YTCECASGY--QGDGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRHT  841

Query  1114  CIDV----NECDLNSNICM---FGECENTKGS-FICHCQLGYSVKKGTTGCTDVDECEIG  1165
             CI +    N C+  S+ C       C +  GS F C C  GY+       CTDVDEC   
Sbjct  842   CILITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQ--CTDVDEC--S  897

Query  1166  AHNCDMHASCVNVPGSFKCSCREGWVGNGIKCI  1198
              + C   A+C N PGSF C C+ G+ G+G +CI
Sbjct  898   ENRCHPAATCYNTPGSFSCRCQPGYYGDGFQCI  930


 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 71/152 (47%), Gaps = 15/152 (10%)

Query  299  GRCIP-TLSSYRCECNMGYKQDSNGDCTDVDECTSNPCS---NGDCVNTPGSYYCKCHAG  354
             RC P T   Y CEC  GY+ D   +C D +EC +       N  C+N PGSY C+C +G
Sbjct  774  ARCHPGTGVDYTCECASGYQGDGR-NCVDENECATGFHRCGPNSVCINLPGSYRCECRSG  832

Query  355  FQRTPTKQACIDI----DECIQNGVLCK---NGRCVNTDGS-FQCICNAGFELTTDGKNC  406
            ++    +  CI I    + C      C      RCV+  GS F C C  G+    DG  C
Sbjct  833  YEFADDRHTCILITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGY--AGDGHQC  890

Query  407  VDHDECTTTNMCLNGMCINEDGSFKCICKPGF  438
             D DEC+         C N  GSF C C+PG+
Sbjct  891  TDVDECSENRCHPAATCYNTPGSFSCRCQPGY  922


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 91/209 (44%), Gaps = 27/209 (13%)

Query  326  DVDECTSNPCSNGD--CVNT----PGS---YYCKCHAGFQRTPTKQACIDIDECIQNGVL  376
            D D    NPC +G   C  T    PG+   Y C+C +G+Q     + C+D +EC      
Sbjct  754  DSDPTPGNPCYDGSHMCDTTARCHPGTGVDYTCECASGYQGD--GRNCVDENECATGFHR  811

Query  377  C-KNGRCVNTDGSFQCICNAGFELTTDGKNCVD--------HDECTTTNMCLNGMCINED  427
            C  N  C+N  GS++C C +G+E   D   C+          D   T        C++  
Sbjct  812  CGPNSVCINLPGSYRCECRSGYEFADDRHTCILITPPANPCEDGSHTCAPAGQARCVHHG  871

Query  428  GS-FKCICKPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCECPPGLAVGVDGR  486
            GS F C C PG+  A +G  CTD+DEC  +       C NT GSF C C PG     DG 
Sbjct  872  GSTFSCACLPGY--AGDGHQCTDVDECSENRCHPAATCYNTPGSFSCRCQPGYY--GDGF  927

Query  487  VCV--DTHMRSTCYGGIKKGACVRPFPGA  513
             C+   T   + C    +       +PGA
Sbjct  928  QCIPDSTSSLTPCEQQQRHAQAQYAYPGA  956


 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 75/150 (50%), Gaps = 28/150 (19%)

Query  1622  FRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGAC  1681
             + CEC +G+  +     C D +EC+ G + C  N+ CIN PGSYRCEC +G++ +     
Sbjct  784   YTCECASGYQGDGR--NCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFAD----  837

Query  1682  VDRNECLEI---PNVCSHG----------LCVDMQGS-YKCICHNGFKASQDQTMCMDVD  1727
              DR+ C+ I    N C  G           CV   GS + C C  G+    D   C DVD
Sbjct  838   -DRHTCILITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAG--DGHQCTDVD  894

Query  1728  ECER---HPCGNGTCKNTVGSYNCLCYPGF  1754
             EC     HP    TC NT GS++C C PG+
Sbjct  895   ECSENRCHPA--ATCYNTPGSFSCRCQPGY  922


 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 109/254 (43%), Gaps = 54/254 (21%)

Query  1633  NDLLLVCEDIDE-----CSNGDNLCQRNADCINSPGS---YRCECAAGFKLSPNGACVDR  1684
             N +  V ED D      C +G ++C   A C   PG+   Y CECA+G++      CVD 
Sbjct  746   NQIGPVKEDSDPTPGNPCYDGSHMCDTTARC--HPGTGVDYTCECASGYQ-GDGRNCVDE  802

Query  1685  NECLEIPNVC-SHGLCVDMQGSYKCICHNGFKASQDQTMCMDV----DECER-----HPC  1734
             NEC    + C  + +C+++ GSY+C C +G++ + D+  C+ +    + CE       P 
Sbjct  803   NECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRHTCILITPPANPCEDGSHTCAPA  862

Query  1735  GNGTCKNTVGS-YNCLCYPGFELTHNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCN  1793
             G   C +  GS ++C C PG+     + C D+DECS    +      C+N  GSF C C 
Sbjct  863   GQARCVHHGGSTFSCACLPGYA-GDGHQCTDVDECSE--NRCHPAATCYNTPGSFSCRCQ  919

Query  1794  EGYELTLDGKNCIDTNECVALP---------------------------GSCSPGTCQNL  1826
              GY    DG  CI  +     P                           G+  P  C   
Sbjct  920   PGY--YGDGFQCIPDSTSSLTPCEQQQRHAQAQYAYPGARFHIPQCDEQGNFLPLQCHGS  977

Query  1827  EGSFRCICPPGYEV  1840
              G   C+ P G+EV
Sbjct  978   TGFCWCVDPDGHEV  991


 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 69/142 (49%), Gaps = 12/142 (8%)

Query  1746  YNCLCYPGFELTHNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNC  1805
             Y C C  G++    N C+D +EC++ F +   N  C N  GS++C C  GYE   D   C
Sbjct  784   YTCECASGYQGDGRN-CVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRHTC  842

Query  1806  I----DTNECVALPGSCSP---GTCQNLEGS-FRCICPPGYEVKSESCIDINECNEDPNI  1857
             I      N C     +C+P     C +  GS F C C PGY      C D++EC+E  N 
Sbjct  843   ILITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQCTDVDECSE--NR  900

Query  1858  CL-FGSCTNTPGGFQCICPTGF  1878
             C    +C NTPG F C C  G+
Sbjct  901   CHPAATCYNTPGSFSCRCQPGY  922


 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 71/157 (45%), Gaps = 19/157 (12%)

Query  960   CRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLC-RNGKCVNMVGTYQCSC  1018
             C  GT V+    + C+C  G++       C+D NEC+     C  N  C+N+ G+Y+C C
Sbjct  776   CHPGTGVD----YTCECASGYQGD--GRNCVDENECATGFHRCGPNSVCINLPGSYRCEC  829

Query  1019  NSGYQATPDRRSCTDIDECMIM-NGGCHT-------HCTNSEGS-YECSCSDGYALMPDV  1069
              SGY+   DR +C  I         G HT        C +  GS + C+C  GYA   D 
Sbjct  830   RSGYEFADDRHTCILITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAG--DG  887

Query  1070  RTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFM  1106
               C D+DEC  N        C N PG + C C  G+ 
Sbjct  888   HQCTDVDECSEN-RCHPAATCYNTPGSFSCRCQPGYY  923


 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 77/187 (41%), Gaps = 30/187 (16%)

Query  1676  SPNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECER--HP  1733
             +P   C D +   +    C  G  VD    Y C C +G++   D   C+D +EC    H 
Sbjct  758   TPGNPCYDGSHMCDTTARCHPGTGVD----YTCECASGYQG--DGRNCVDENECATGFHR  811

Query  1734  CG-NGTCKNTVGSYNCLCYPGFELTHN-----------NDCMDIDECSSFFGQVCRNGRC  1781
             CG N  C N  GSY C C  G+E   +           N C D     +  GQ     RC
Sbjct  812   CGPNSVCINLPGSYRCECRSGYEFADDRHTCILITPPANPCEDGSHTCAPAGQ----ARC  867

Query  1782  FNEIGS-FKCLCNEGYELTLDGKNCIDTNECVALPGSCSPG-TCQNLEGSFRCICPPGYE  1839
              +  GS F C C  GY    DG  C D +EC      C P  TC N  GSF C C PGY 
Sbjct  868   VHHGGSTFSCACLPGY--AGDGHQCTDVDECSE--NRCHPAATCYNTPGSFSCRCQPGYY  923

Query  1840  VKSESCI  1846
                  CI
Sbjct  924   GDGFQCI  930


 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 66/144 (46%), Gaps = 17/144 (12%)

Query  552  GITVDGR---DINECALDPDIC-SNGICENLRGSYRCNCNSGYEPDPSGRNCVDI----D  603
            G   DGR   D NECA     C  N +C NL GSYRC C SGYE       C+ I    +
Sbjct  791  GYQGDGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRHTCILITPPAN  850

Query  604  ECSVNRLLCD---NGLCRNTPGS-YSCTCPKGYVFSTETDTCEDINECESSPCVNGA-CR  658
             C      C       C +  GS +SC C  GY  + +   C D++EC  + C   A C 
Sbjct  851  PCEDGSHTCAPAGQARCVHHGGSTFSCACLPGY--AGDGHQCTDVDECSENRCHPAATCY  908

Query  659  NNLGSFNCECSPGSKLDSTGLICI  682
            N  GSF+C C PG   D  G  CI
Sbjct  909  NTPGSFSCRCQPGYYGD--GFQCI  930


 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 76/181 (42%), Gaps = 46/181 (25%)

Query  887   FKCKCNSGFTLDMEERNCTDIDECWISPDLCG-SGTCVNTPGSFECECFDGYESGFMMMK  945
             + C+C SG+  D   RNC D +EC      CG +  C+N PGS+ CEC  GYE  F   +
Sbjct  784   YTCECASGYQGDG--RNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYE--FADDR  839

Query  946   NCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNG  1005
             +   +     NP  C        +GS  C  P G                          
Sbjct  840   HTCILITPPANP--CE-------DGSHTC-APAG------------------------QA  865

Query  1006  KCVNMVG-TYQCSCNSGYQATPDRRSCTDIDECMIMNGGCH--THCTNSEGSYECSCSDG  1062
             +CV+  G T+ C+C  GY    D   CTD+DEC      CH    C N+ GS+ C C  G
Sbjct  866   RCVHHGGSTFSCACLPGYAG--DGHQCTDVDEC--SENRCHPAATCYNTPGSFSCRCQPG  921

Query  1063  Y  1063
             Y
Sbjct  922   Y  922


 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 64/202 (32%), Positives = 83/202 (41%), Gaps = 61/202 (30%)

Query  582  YRCNCNSGYEPDPSGRNCVDIDECSVNRLLC-DNGLCRNTPGSYSCTCPKGYVFSTETDT  640
            Y C C SGY+ D  GRNCVD +EC+     C  N +C N PGSY C C  GY F+ +  T
Sbjct  784  YTCECASGYQGD--GRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRHT  841

Query  641  CEDINECESSPCVNGACRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDSRCEV  700
            C  I    ++PC +G+           C+P  +                      +RC V
Sbjct  842  CILITP-PANPCEDGSH---------TCAPAGQ----------------------ARC-V  868

Query  701  NINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVNGVTCEDVNECDVFPGVC-PN  759
            +  G+T     CA                  C  G+A  +G  C DV+EC      C P 
Sbjct  869  HHGGSTF---SCA------------------CLPGYAG-DGHQCTDVDECSE--NRCHPA  904

Query  760  GRCINSRGSFHCECPEGLTLDG  781
              C N+ GSF C C  G   DG
Sbjct  905  ATCYNTPGSFSCRCQPGYYGDG  926


> sp|O15232|MATN3_HUMAN Matrilin-3 OS=Homo sapiens GN=MATN3 PE=1 
SV=2
Length=486

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 85/166 (51%), Gaps = 15/166 (9%)

Query  1200  LDECSNGTHQCSVNAQCVNS-PGSYLCACVEGFT--GDGFTCSDVDECAENVHLCENGQC  1256
             LD C  GTHQC     C++   G + C C +G+T   D  TCS +D CA N H CE+   
Sbjct  265   LDPCVLGTHQC--QHVCISDGEGKHHCECSQGYTLNADKKTCSALDRCALNTHGCEHICV  322

Query  1257  LNVPGAYRCECEMGFTPASDSKSCQDINECSF-----QNICVFGTCNNLPGMFHCICDDG  1311
              +  G+Y CEC  G+T   D K+C   ++C+      Q+ICV    N+  G  HC C +G
Sbjct  323   NDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQHICV----NDRTGSHHCECYEG  378

Query  1312  YELDRTGGNCTDVDECADPINCVNGLCVNT-PGRYECNCPPDFQLN  1356
             Y L+     C+  D+CA   +    +CV+     Y C+C P + LN
Sbjct  379   YTLNADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYPGYTLN  424


 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 74/153 (48%), Gaps = 1/153 (1%)

Query  1012  GTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSE-GSYECSCSDGYALMPDVR  1070
             G + C C+ GY    D+++C+ +D C +   GC   C N   GSY C C +GY L  D +
Sbjct  285   GKHHCECSQGYTLNADKKTCSALDRCALNTHGCEHICVNDRSGSYHCECYEGYTLNEDRK  344

Query  1071  TCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFG  1130
             TC+  D+C      C      +  G + C CY+G+  + D KTC   ++C L S+ C   
Sbjct  345   TCSAQDKCALGTHGCQHICVNDRTGSHHCECYEGYTLNADKKTCSVRDKCALGSHGCQHI  404

Query  1131  ECENTKGSFICHCQLGYSVKKGTTGCTDVDECE  1163
                +   S+ C C  GY++ +    C+  +E  
Sbjct  405   CVSDGAASYHCDCYPGYTLNEDKKTCSATEEAR  437


 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 78/161 (48%), Gaps = 2/161 (1%)

Query  1034  IDECMIMNGGCHTHC-TNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTN  1092
             +D C++    C   C ++ EG + C CS GY L  D +TC+ +D C  N   C+     +
Sbjct  265   LDPCVLGTHQCQHVCISDGEGKHHCECSQGYTLNADKKTCSALDRCALNTHGCEHICVND  324

Query  1093  IPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKG  1152
               G Y C CY+G+  + D KTC   ++C L ++ C      +  GS  C C  GY++   
Sbjct  325   RSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQHICVNDRTGSHHCECYEGYTLNAD  384

Query  1153  TTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGN  1193
                C+  D+C +G+H C  H    +   S+ C C  G+  N
Sbjct  385   KKTCSVRDKCALGSHGC-QHICVSDGAASYHCDCYPGYTLN  424


 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 87/179 (49%), Gaps = 17/179 (9%)

Query  1159  VDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIK--CIDLDECSNGTHQCSVNAQC  1216
             +D C +G H C  H    +  G   C C +G+  N  K  C  LD C+  TH C     C
Sbjct  265   LDPCVLGTHQC-QHVCISDGEGKHHCECSQGYTLNADKKTCSALDRCALNTHGC--EHIC  321

Query  1217  VN-SPGSYLCACVEGFT--GDGFTCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTP  1273
             VN   GSY C C EG+T   D  TCS  D+CA   H C++    +  G++ CEC  G+T 
Sbjct  322   VNDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQHICVNDRTGSHHCECYEGYTL  381

Query  1274  ASDSKSCQDINECSF-----QNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDEC  1327
              +D K+C   ++C+      Q+ICV    ++    +HC C  GY L+     C+  +E 
Sbjct  382   NADKKTCSVRDKCALGSHGCQHICV----SDGAASYHCDCYPGYTLNEDKKTCSATEEA  436


 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 90/187 (48%), Gaps = 10/187 (5%)

Query  1106  MASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIG  1165
             ++S   +T   ++ C L ++ C      + +G   C C  GY++      C+ +D C + 
Sbjct  254   LSSRFQETFCALDPCVLGTHQCQHVCISDGEGKHHCECSQGYTLNADKKTCSALDRCALN  313

Query  1166  AHNCDMHASCVN-VPGSFKCSCREGWVGNGIK--CIDLDECSNGTHQCSVNAQCVN-SPG  1221
              H C+    CVN   GS+ C C EG+  N  +  C   D+C+ GTH C     CVN   G
Sbjct  314   THGCEH--ICVNDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGC--QHICVNDRTG  369

Query  1222  SYLCACVEGFT--GDGFTCSDVDECAENVHLCENGQCLNVPGAYRCECEMGFTPASDSKS  1279
             S+ C C EG+T   D  TCS  D+CA   H C++    +   +Y C+C  G+T   D K+
Sbjct  370   SHHCECYEGYTLNADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYPGYTLNEDKKT  429

Query  1280  CQDINEC  1286
             C    E 
Sbjct  430   CSATEEA  436


 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 83/176 (47%), Gaps = 6/176 (3%)

Query  907   IDECWISPDLCGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCV  966
             +D C +    C      +  G   CEC  GY       K C  +D C  N   C    CV
Sbjct  265   LDPCVLGTHQCQHVCISDGEGKHHCECSQGYTLN-ADKKTCSALDRCALNTHGCEH-ICV  322

Query  967   NTE-GSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGKCVN-MVGTYQCSCNSGYQA  1024
             N   GS+ C+C  G+ L+  R+ C   ++C+L    C++  CVN   G++ C C  GY  
Sbjct  323   NDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQH-ICVNDRTGSHHCECYEGYTL  381

Query  1025  TPDRRSCTDIDECMIMNGGCHTHC-TNSEGSYECSCSDGYALMPDVRTCADIDECE  1079
               D+++C+  D+C + + GC   C ++   SY C C  GY L  D +TC+  +E  
Sbjct  382   NADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYPGYTLNEDKKTCSATEEAR  437


 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 85/181 (47%), Gaps = 13/181 (7%)

Query  1078  CESNPDICDGGQCTNI-----PGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGEC  1132
             C  +P +    QC ++      G++ C C  G+  + D KTC  ++ C LN++ C     
Sbjct  263   CALDPCVLGTHQCQHVCISDGEGKHHCECSQGYTLNADKKTCSALDRCALNTHGCEHICV  322

Query  1133  ENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCREGWVG  1192
              +  GS+ C C  GY++ +    C+  D+C +G H C  H    +  GS  C C EG+  
Sbjct  323   NDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGC-QHICVNDRTGSHHCECYEGYTL  381

Query  1193  NGIK--CIDLDECSNGTHQCSVNAQCV-NSPGSYLCACVEGFT--GDGFTCSDVDECAEN  1247
             N  K  C   D+C+ G+H C     CV +   SY C C  G+T   D  TCS  +E    
Sbjct  382   NADKKTCSVRDKCALGSHGC--QHICVSDGAASYHCDCYPGYTLNEDKKTCSATEEARRL  439

Query  1248  V  1248
             V
Sbjct  440   V  440


 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 80/158 (51%), Gaps = 5/158 (3%)

Query  885   GSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVN-TPGSFECECFDGYESGFMM  943
             G   C+C+ G+TL+ +++ C+ +D C ++   C    CVN   GS+ CEC++GY      
Sbjct  285   GKHHCECSQGYTLNADKKTCSALDRCALNTHGC-EHICVNDRSGSYHCECYEGYTLN-ED  342

Query  944   MKNCMDIDECERNPLLCRGGTCVNTE-GSFQCDCPLGHELSPSREECIDVNECSLSDSLC  1002
              K C   D+C      C+   CVN   GS  C+C  G+ L+  ++ C   ++C+L    C
Sbjct  343   RKTCSAQDKCALGTHGCQ-HICVNDRTGSHHCECYEGYTLNADKKTCSVRDKCALGSHGC  401

Query  1003  RNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIM  1040
             ++    +   +Y C C  GY    D+++C+  +E   +
Sbjct  402   QHICVSDGAASYHCDCYPGYTLNEDKKTCSATEEARRL  439


 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 79/177 (45%), Gaps = 6/177 (3%)

Query  1642  IDECSNGDNLCQRNADCINS-PGSYRCECAAGFKLSPNG-ACVDRNECLEIPNVCSHGLC  1699
             +D C  G + CQ    CI+   G + CEC+ G+ L+ +   C   + C    + C H   
Sbjct  265   LDPCVLGTHQCQHV--CISDGEGKHHCECSQGYTLNADKKTCSALDRCALNTHGCEHICV  322

Query  1700  VDMQGSYKCICHNGFKASQDQTMCMDVDECE--RHPCGNGTCKNTVGSYNCLCYPGFELT  1757
              D  GSY C C+ G+  ++D+  C   D+C    H C +    +  GS++C CY G+ L 
Sbjct  323   NDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQHICVNDRTGSHHCECYEGYTLN  382

Query  1758  HNNDCMDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVAL  1814
              +     + +  +     C++    +   S+ C C  GY L  D K C  T E   L
Sbjct  383   ADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYPGYTLNEDKKTCSATEEARRL  439


 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 69/150 (46%), Gaps = 4/150 (3%)

Query  345  GSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVN-TDGSFQCICNAGFELTTDG  403
            G ++C+C  G+     K+ C  +D C  N   C++  CVN   GS+ C C  G+ L  D 
Sbjct  285  GKHHCECSQGYTLNADKKTCSALDRCALNTHGCEH-ICVNDRSGSYHCECYEGYTLNEDR  343

Query  404  KNCVDHDECTTTNMCLNGMCINED-GSFKCICKPGFVLAPNGRYCTDIDECQTSGICMNG  462
            K C   D+C         +C+N+  GS  C C  G+ L  + + C+  D+C         
Sbjct  344  KTCSAQDKCALGTHGCQHICVNDRTGSHHCECYEGYTLNADKKTCSVRDKCALGSHGCQH  403

Query  463  HCINT-EGSFRCECPPGLAVGVDGRVCVDT  491
             C++    S+ C+C PG  +  D + C  T
Sbjct  404  ICVSDGAASYHCDCYPGYTLNEDKKTCSAT  433


 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 75/153 (49%), Gaps = 6/153 (4%)

Query  307  SYRCECNMGYKQDSNGD-CTDVDECTSNPCS-NGDCVN-TPGSYYCKCHAGFQRTPTKQA  363
             + CEC+ GY  +++   C+ +D C  N       CVN   GSY+C+C+ G+     ++ 
Sbjct  286  KHHCECSQGYTLNADKKTCSALDRCALNTHGCEHICVNDRSGSYHCECYEGYTLNEDRKT  345

Query  364  CIDIDECIQNGVLCKNGRCVN-TDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGM  422
            C   D+C      C++  CVN   GS  C C  G+ L  D K C   D+C   +     +
Sbjct  346  CSAQDKCALGTHGCQHI-CVNDRTGSHHCECYEGYTLNADKKTCSVRDKCALGSHGCQHI  404

Query  423  CINE-DGSFKCICKPGFVLAPNGRYCTDIDECQ  454
            C+++   S+ C C PG+ L  + + C+  +E +
Sbjct  405  CVSDGAASYHCDCYPGYTLNEDKKTCSATEEAR  437


 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 63/121 (52%), Gaps = 5/121 (4%)

Query  1614  VCIN-QIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCIN-SPGSYRCECAA  1671
             +C+N + GS+ CEC  G++ N+    C   D+C+ G + CQ    C+N   GS+ CEC  
Sbjct  320   ICVNDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQHI--CVNDRTGSHHCECYE  377

Query  1672  GFKLSPN-GACVDRNECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECE  1730
             G+ L+ +   C  R++C    + C H    D   SY C C+ G+  ++D+  C   +E  
Sbjct  378   GYTLNADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYPGYTLNEDKKTCSATEEAR  437

Query  1731  R  1731
             R
Sbjct  438   R  438


 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 66/155 (43%), Gaps = 14/155 (9%)

Query  1694  CSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECE--RHPCGNGTCKNTVGSYNCLCY  1751
             C H    D +G + C C  G+  + D+  C  +D C    H C +    +  GSY+C CY
Sbjct  275   CQHVCISDGEGKHHCECSQGYTLNADKKTCSALDRCALNTHGCEHICVNDRSGSYHCECY  334

Query  1752  PGFELTHNND-CMDIDECSSFFG-----QVCRNGRCFNEIGSFKCLCNEGYELTLDGKNC  1805
              G+ L  +   C   D+C+   G      +C N R     GS  C C EGY L  D K C
Sbjct  335   EGYTLNEDRKTCSAQDKCA--LGTHGCQHICVNDR----TGSHHCECYEGYTLNADKKTC  388

Query  1806  IDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEV  1840
                ++C      C      +   S+ C C PGY +
Sbjct  389   SVRDKCALGSHGCQHICVSDGAASYHCDCYPGYTL  423


 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 78/170 (46%), Gaps = 7/170 (4%)

Query  533  HPCPAKNSAEFHGLCSSGIGITVDGRD---INECALDPDICSNGICENLR-GSYRCNCNS  588
            H C +    + H  CS G  +  D +    ++ CAL+   C + IC N R GSY C C  
Sbjct  277  HVCISDGEGKHHCECSQGYTLNADKKTCSALDRCALNTHGCEH-ICVNDRSGSYHCECYE  335

Query  589  GYEPDPSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCEDINECE  648
            GY  +   + C   D+C++    C +    +  GS+ C C +GY  + +  TC   ++C 
Sbjct  336  GYTLNEDRKTCSAQDKCALGTHGCQHICVNDRTGSHHCECYEGYTLNADKKTCSVRDKCA  395

Query  649  --SSPCVNGACRNNLGSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDS  696
              S  C +    +   S++C+C PG  L+     C  + +    ++ +D+
Sbjct  396  LGSHGCQHICVSDGAASYHCDCYPGYTLNEDKKTCSATEEARRLVSTEDA  445


 Score = 55.5 bits (132),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 65/136 (48%), Gaps = 9/136 (7%)

Query  563  CALDPDICSNGICENL-----RGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLC  617
            CALDP +     C+++      G + C C+ GY  +   + C  +D C++N   C++   
Sbjct  263  CALDPCVLGTHQCQHVCISDGEGKHHCECSQGYTLNADKKTCSALDRCALNTHGCEHICV  322

Query  618  RNTPGSYSCTCPKGYVFSTETDTCEDINECE--SSPCVNGACRNNLGSFNCECSPGSKLD  675
             +  GSY C C +GY  + +  TC   ++C   +  C +    +  GS +CEC  G  L+
Sbjct  323  NDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQHICVNDRTGSHHCECYEGYTLN  382

Query  676  STGLICIDSLKGTCWL  691
            +    C  S++  C L
Sbjct  383  ADKKTC--SVRDKCAL  396


> sp|O00548|DLL1_HUMAN Delta-like protein 1 OS=Homo sapiens GN=DLL1 
PE=2 SV=2
Length=723

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 106/330 (32%), Positives = 144/330 (44%), Gaps = 69/330 (21%)

Query  349  CKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFE---LTTDGKN  405
            CKC  G+Q     + C   DECI+    C +G C      +QC C  G+       D   
Sbjct  243  CKCRVGWQ----GRYC---DECIRY-PGCLHGTCQQ---PWQCNCQEGWGGLFCNQDLNY  291

Query  406  CVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYC-TDIDECQTSGICMNGHC  464
            C  H  C     C N       GS+ C C+PG+     G  C   IDEC  S     G C
Sbjct  292  CTHHKPCKNGATCTN----TGQGSYTCSCRPGYT----GATCELGIDECDPSPCKNGGSC  343

Query  465  INTEGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANP  524
             + E S+ C CPPG      G++C  + M  TC      G C   F G       C  +P
Sbjct  344  TDLENSYSCTCPPGFY----GKICELSAM--TC----ADGPC---FNGGR-----CSDSP  385

Query  525  DYGFGEPCHPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICSNGI-CENLRGSYR  583
            D G+   C  CP   S           G   + + I+ C+  P  CSNG  C +L  +Y 
Sbjct  386  DGGYS--CR-CPVGYS-----------GFNCE-KKIDYCSSSP--CSNGAKCVDLGDAYL  428

Query  584  CNCNSGYEPDPSGRNCVD-IDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCE  642
            C C +G+    SGR+C D +D+C+ +    + G CR+    +SCTCP GY   T  +   
Sbjct  429  CRCQAGF----SGRHCDDNVDDCA-SSPCANGGTCRDGVNDFSCTCPPGY---TGRNCSA  480

Query  643  DINECESSPCVNGA-CRNNLGSFNCECSPG  671
             ++ CE +PC NGA C      + CEC+ G
Sbjct  481  PVSRCEHAPCHNGATCHERGHRYVCECARG  510


 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 79/247 (32%), Positives = 115/247 (47%), Gaps = 37/247 (15%)

Query  1601  DECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCIN  1660
             DEC   PG C +G C      ++C C  G+     L   +D++ C++    C+  A C N
Sbjct  255   DECIRYPG-CLHGTCQQ---PWQCNCQEGWG---GLFCNQDLNYCTH-HKPCKNGATCTN  306

Query  1661  S-PGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHG-LCVDMQGSYKCICHNGFKASQ  1718
             +  GSY C C  G+  +     +D  EC   P+ C +G  C D++ SY C C  GF    
Sbjct  307   TGQGSYTCSCRPGYTGATCELGID--EC--DPSPCKNGGSCTDLENSYSCTCPPGFYGKI  362

Query  1719  DQTMCMDVDECERHPCGNG-TCKNTV-GSYNCLC---YPGFELTHNNDCMDIDECSSFFG  1773
              +   M    C   PC NG  C ++  G Y+C C   Y GF          ID CSS   
Sbjct  363   CELSAM---TCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKK-----IDYCSS---  411

Query  1774  QVCRNG-RCFNEIGSFKCLCNEGYELTLDGKNCID-TNECVALPGSCSPGTCQNLEGSFR  1831
               C NG +C +   ++ C C  G+     G++C D  ++C + P + + GTC++    F 
Sbjct  412   SPCSNGAKCVDLGDAYLCRCQAGFS----GRHCDDNVDDCASSPCA-NGGTCRDGVNDFS  466

Query  1832  CICPPGY  1838
             C CPPGY
Sbjct  467   CTCPPGY  473


 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 90/315 (29%), Positives = 130/315 (41%), Gaps = 54/315 (17%)

Query  930   ECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREEC  989
             EC+C  G++  +         DEC R P  C  GTC   +  +QC+C  G       +  
Sbjct  242   ECKCRVGWQGRY--------CDECIRYPG-CLHGTC---QQPWQCNCQEGWGGLFCNQ--  287

Query  990   IDVNECSLSDSLCRNGK-CVNM-VGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTH  1047
              D+N C+     C+NG  C N   G+Y CSC  GY          + D     NGG    
Sbjct  288   -DLNYCT-HHKPCKNGATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGG---S  342

Query  1048  CTNSEGSYECSCSDGYALM---PDVRTCADIDECESNPDICDGGQCTNIP-GEYRCLC--  1101
             CT+ E SY C+C  G+          TCAD           +GG+C++ P G Y C C  
Sbjct  343   CTDLENSYSCTCPPGFYGKICELSAMTCAD-------GPCFNGGRCSDSPDGGYSCRCPV  395

Query  1102  -YDGFMASMDMKTCIDVNECDLNSNICMFG-ECENTKGSFICHCQLGYSVKKGTTGCTD-  1158
              Y GF     +  C        +S+ C  G +C +   +++C CQ G+S +     C D 
Sbjct  396   GYSGFNCEKKIDYC--------SSSPCSNGAKCVDLGDAYLCRCQAGFSGRH----CDDN  443

Query  1159  VDECEIGAHNCDMHASCVNVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVN  1218
             VD+C   +  C    +C +    F C+C  G+ G       +  C +    C   A C  
Sbjct  444   VDDC--ASSPCANGGTCRDGVNDFSCTCPPGYTGRNCS-APVSRCEHAP--CHNGATCHE  498

Query  1219  SPGSYLCACVEGFTG  1233
                 Y+C C  G+ G
Sbjct  499   RGHRYVCECARGYGG  513


 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 131/308 (43%), Gaps = 48/308 (16%)

Query  1015  QCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRTCAD  1074
             +C C  G+Q     R C   DEC+   G  H  C   +  ++C+C +G+     +    D
Sbjct  242   ECKCRVGWQG----RYC---DECIRYPGCLHGTC---QQPWQCNCQEGWG---GLFCNQD  288

Query  1075  IDECESNPDICDGGQCTNI-PGEYRCLCYDGFMASMDMKTC-IDVNECDLNSNICMFGEC  1132
             ++ C  +    +G  CTN   G Y C C  G+  +    TC + ++ECD  S     G C
Sbjct  289   LNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGA----TCELGIDECD-PSPCKNGGSC  343

Query  1133  ENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCD-----MHASCVNVP-GSFKCSC  1186
              + + S+ C C  G+  K           CE+ A  C          C + P G + C C
Sbjct  344   TDLENSYSCTCPPGFYGKI----------CELSAMTCADGPCFNGGRCSDSPDGGYSCRC  393

Query  1187  REGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSD-VDECA  1245
               G+ G   +   +D CS  +  CS  A+CV+   +YLC C  GF+G    C D VD+CA
Sbjct  394   PVGYSGFNCE-KKIDYCS--SSPCSNGAKCVDLGDAYLCRCQAGFSGR--HCDDNVDDCA  448

Query  1246  ENVHLCEN-GQCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMF  1304
              +   C N G C +    + C C  G+T  + S     ++ C         TC+     +
Sbjct  449   SSP--CANGGTCRDGVNDFSCTCPPGYTGRNCSAP---VSRCEHAPCHNGATCHERGHRY  503

Query  1305  HCICDDGY  1312
              C C  GY
Sbjct  504   VCECARGY  511


> sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens GN=STAB2 PE=1 
SV=3
Length=2551

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 84/262 (32%), Positives = 125/262 (48%), Gaps = 43/262 (16%)

Query  1080  SNPDICDG-GQCTN-IPGEYRCLCYDGFMASMDMKTCIDVNECDLNSN---ICMFGECEN  1134
             SNP  C G GQC + + G   C+C +GF  S   + C D N+     N   +C+ G C N
Sbjct  745   SNP--CSGNGQCADSLGGNGTCICEEGFQGS-QCQFCSDPNKYGPRCNKKCLCVHGTCNN  801

Query  1135  TKGS----FICHCQLGYSVK---KGTTGCTDVDECEIGAHNCDMHASCVNVPGSFKCSCR  1187
                S        C+ G + +   K T+ C            C +HA+C    G+  C C+
Sbjct  802   RIDSDGACLTGTCRDGSAGRLCDKQTSACGPY------VQFCHIHATCEYSNGTASCICK  855

Query  1188  EGWVGNGIKCIDLDECSNGTH-QCSVNAQCVNS-PGSYLCACVEGFTGDGFTCSDVDEC-  1244
              G+ G+G  C ++D C+  T   CS NA+C+ +  G++ C C +G+TG+G  CS+++ C 
Sbjct  856   AGYEGDGTLCSEMDPCTGLTPGGCSRNAECIKTGTGTHTCVCQQGWTGNGRDCSEINNCL  915

Query  1245  ---AENVHLCENGQCLNV-PGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNL  1300
                A   H  +N  CL V PG   CEC+ GF    +   C+ I  C  Q     G C+ L
Sbjct  916   LPSAGGCH--DNASCLYVGPGQNECECKKGFR--GNGIDCEPITSCLEQT----GKCHPL  967

Query  1301  P-------GMFHCICDDGYELD  1315
                     G++ C+C +GYE D
Sbjct  968   ASCQSTSSGVWSCVCQEGYEGD  989


 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 63/125 (50%), Gaps = 9/125 (7%)

Query  1134  NTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNV-PGSFKCSCREGWVG  1192
             N+ G+  C C  G+  +   T CT ++ CEI    C   A C    PG   C+C+ G+ G
Sbjct  1449  NSDGTASCKCAAGF--QGNGTICTAINACEISNGGCSAKADCKRTTPGRRVCTCKAGYTG  1506

Query  1193  NGIKCIDLDECSNGTHQCSVNAQCVNS-PGSYLCACVEGFTGDGFTCSDVDECAENVHLC  1251
             +GI C++++ C      C  NA+C  + P    C C+  +TGDG  C+ ++ C     L 
Sbjct  1507  DGIVCLEINPCLENHGGCDKNAECTQTGPNQAACNCLPAYTGDGKVCTLINVC-----LT  1561

Query  1252  ENGQC  1256
             +NG C
Sbjct  1562  KNGGC  1566


 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 71/153 (46%), Gaps = 15/153 (10%)

Query  1169  CDMHASCV-NVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNS-PGSYLCA  1226
             C   A+C+ N  G+  C C  G+ GNG  C  ++ C      CS  A C  + PG  +C 
Sbjct  1440  CHTSANCLTNSDGTASCKCAAGFQGNGTICTAINACEISNGGCSAKADCKRTTPGRRVCT  1499

Query  1227  CVEGFTGDGFTCSDVDECAENVHLCE-NGQCLNV-PGAYRCECEMGFTPASDSKSCQDIN  1284
             C  G+TGDG  C +++ C EN   C+ N +C    P    C C   +T   D K C  IN
Sbjct  1500  CKAGYTGDGIVCLEINPCLENHGGCDKNAECTQTGPNQAACNCLPAYT--GDGKVCTLIN  1557

Query  1285  ECSFQNICVFGTCNNLPGMFHCICDDGYELDRT  1317
              C  +N    G C+        IC+   +++RT
Sbjct  1558  VCLTKN----GGCSEF-----AICNHTGQVERT  1581


 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 54/111 (49%), Gaps = 14/111 (13%)

Query  1169  CDMHASCVNVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACV  1228
             C  HA+C     +  C C   + G+GI C  +D C      C+  A+C        C+C 
Sbjct  2055  CSAHATCKE---NNTCECNLDYEGDGITCTVVDFCKQDNGGCAKVARCSQKGTKVSCSCQ  2111

Query  1229  EGFTGDGFTCSDVDECAENVHLCENGQC-------LNVPGAYRCECEMGFT  1272
             +G+ GDG +C+++D CA+ +    NG C       +  PG ++CEC+  + 
Sbjct  2112  KGYKGDGHSCTEIDPCADGL----NGGCHEHATCKMTGPGKHKCECKSHYV  2158


> sp|Q9NY15|STAB1_HUMAN Stabilin-1 OS=Homo sapiens GN=STAB1 PE=1 
SV=3
Length=2570

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 86/173 (50%), Gaps = 12/173 (7%)

Query  1127  CMFGECENTKGSF-ICH---CQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPGSF  1182
             C+ G C+N  GS  +C    C  G+S +       D     +  H C +HA CV+  G  
Sbjct  786   CVHGLCDNRPGSGGVCQQGTCAPGFSGRFCNESMGDCGPTGLAQH-CHLHARCVSQEGVA  844

Query  1183  KCSCREGWVGNGIKCIDLDECSNGTH-QCSVNAQCV-NSPGSYLCACVEGFTGDGFTCSD  1240
             +C C +G+ G+G  C   + CS+     CS NA+CV  S G++ C C +G++GDG  C  
Sbjct  845   RCRCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGSLGTHHCTCHKGWSGDGRVCVA  904

Query  1241  VDECAENVH--LCENGQCLNV-PGAYRCECEMGFTPASDSKSCQDINECSFQN  1290
             +DEC  ++      +  C  V PG  RC C++GF  A D   C  I+ C   N
Sbjct  905   IDECELDMRGGCHTDALCSYVGPGQSRCTCKLGF--AGDGYQCSPIDPCRAGN  955


 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 90/346 (26%), Positives = 144/346 (42%), Gaps = 46/346 (13%)

Query  990   IDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCT  1049
             +  + C  S +     KCVN    ++C+     Q TP R+SC         + GC   C 
Sbjct  1255  VGSSRCLHSHAEALREKCVNCTRRFRCTQGFQLQDTP-RKSCV-YRSGFSFSRGCSYTCA  1312

Query  1050  NSEGSYECSCSDGYALMPDVRTCADIDECESNPD----ICDG-GQCTN-IPGEYRCLCYD  1103
                   +C C   +  +           CE  P     +C G GQC +   G   C C++
Sbjct  1313  KKIQVPDC-CPGFFGTL-----------CEPCPGGLGGVCSGHGQCQDRFLGSGECHCHE  1360

Query  1104  GFMASM--------DMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTG  1155
             GF  +             C  V  CD    +C     E  +G   C C +G+   +    
Sbjct  1361  GFHGTACEVCELGRYGPNCTGV--CDCAHGLCQ----EGLQGDGSCVCNVGWQGLRCDQK  1414

Query  1156  CTDVDECEIGAHNCDMHASCV-NVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSVNA  1214
              T   +C      CD +A+CV +  G+  C+C  G+ GNGI C ++D C++G   CS +A
Sbjct  1415  ITS-PQC---PRKCDPNANCVQDSAGASTCACAAGYSGNGIFCSEVDPCAHGHGGCSPHA  1470

Query  1215  QCVN-SPGSYLCACVEGFTGDGFTCSDVDECAENVHLCE-NGQCLNV-PGAYRCECEMGF  1271
              C   +PG   C C +G+ GDG  C +++ C  +   C  + +C+   P    C C  G+
Sbjct  1471  NCTKVAPGQRTCTCQDGYMGDGELCQEINSCLIHHGGCHIHAECIPTGPQQVSCSCREGY  1530

Query  1272  TPASDSKSCQDINECSFQN--ICVFGTCNNL-PGMFHCICDDGYEL  1314
             +     ++C+ ++ CS  N     + TC +   G   C CD  + +
Sbjct  1531  S-GDGIRTCELLDPCSKNNGGCSPYATCKSTGDGQRTCTCDTAHTV  1575


 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 78/185 (42%), Gaps = 18/185 (10%)

Query  1088  GQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTK------GSFIC  1141
              +C +  G  RC C DGF    D  +C   N C   S+    G  EN +      G+  C
Sbjct  835   ARCVSQEGVARCRCLDGFEG--DGFSCTPSNPC---SHPDRGGCSENAECVPGSLGTHHC  889

Query  1142  HCQLGYSVKKGTTGCTDVDECEIGAHN-CDMHASCVNV-PGSFKCSCREGWVGNGIKCID  1199
              C  G+S       C  +DECE+     C   A C  V PG  +C+C+ G+ G+G +C  
Sbjct  890   TCHKGWSGDGRV--CVAIDECELDMRGGCHTDALCSYVGPGQSRCTCKLGFAGDGYQCSP  947

Query  1200  LDECSNGTHQCSVNAQC-VNSPGSYLCACVEGFTGDGFTCSD--VDECAENVHLCENGQC  1256
             +D C  G   C   A C     G  +C C  GF GDGF+C      E   N H     Q 
Sbjct  948   IDPCRAGNGGCHGLATCRAVGGGQRVCTCPPGFGGDGFSCYGDIFRELEANAHFSIFYQW  1007

Query  1257  LNVPG  1261
             L   G
Sbjct  1008  LKSAG  1012


 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 74/162 (46%), Gaps = 24/162 (15%)

Query  1207  THQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECA--ENVHLCENGQCLNVPGA--  1262
                C ++A+CV+  G   C C++GF GDGF+C+  + C+  +     EN +C  VPG+  
Sbjct  828   AQHCHLHARCVSQEGVARCRCLDGFEGDGFSCTPSNPCSHPDRGGCSENAEC--VPGSLG  885

Query  1263  -YRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNL-------PGMFHCICDDGYEL  1314
              + C C  G++   D + C  I+EC      + G C+         PG   C C  G+  
Sbjct  886   THHCTCHKGWS--GDGRVCVAIDECELD---MRGGCHTDALCSYVGPGQSRCTCKLGFAG  940

Query  1315  DRTGGNCTDVDECADPINCVNGLCVNTP---GRYECNCPPDF  1353
             D  G  C+ +D C       +GL        G+  C CPP F
Sbjct  941   D--GYQCSPIDPCRAGNGGCHGLATCRAVGGGQRVCTCPPGF  980


> sp|P98164|LRP2_HUMAN Low-density lipoprotein receptor-related 
protein 2 OS=Homo sapiens GN=LRP2 PE=1 SV=3
Length=4655

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/211 (31%), Positives = 95/211 (45%), Gaps = 32/211 (15%)

Query  917   CGSGTCVNTPGSFECECFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCD-  975
             CG G C+  P  F C+  +     +   + C+    C++N   C+ G C++   +F CD 
Sbjct  3000  CGYGLCI--PKIFRCDRHNDC-GDYSDERGCL-YQTCQQNQFTCQNGRCISK--TFVCDE  3053

Query  976   -----------CPLGHELSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQA  1024
                          L H   P+         C   +  C NG+C+ M+    C+       
Sbjct  3054  DNDCGDGSDELMHLCHTPEPT---------CPPHEFKCDNGRCIEMMKL--CNHLDDCLD  3102

Query  1025  TPDRRSCTDIDECMIMN-GGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPD  1083
               D + C  I+EC   +  GC  +CT++  S+ CSC  GY LM D RTC DIDEC   P 
Sbjct  3103  NSDEKGCG-INECHDPSISGCDHNCTDTLTSFYCSCRPGYKLMSDKRTCVDIDECTEMPF  3161

Query  1084  ICDGGQCTNIPGEYRCLCYDGFMASMDMKTC  1114
             +C   +C N+ G Y C C  G++   D KTC
Sbjct  3162  VC-SQKCENVIGSYICKCAPGYLREPDGKTC  3191


 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 64/142 (45%), Gaps = 7/142 (5%)

Query  982   LSPSREECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMN  1041
             L  S E+   +NEC        +  C + + ++ CSC  GY+   D+R+C DIDEC  M 
Sbjct  3101  LDNSDEKGCGINECHDPSISGCDHNCTDTLTSFYCSCRPGYKLMSDKRTCVDIDECTEMP  3160

Query  1042  GGCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLC  1101
               C   C N  GSY C C+ GY   PD +TC      E  P +    +        R L 
Sbjct  3161  FVCSQKCENVIGSYICKCAPGYLREPDGKTCRQNSNIE--PYLIFSNRYY-----LRNLT  3213

Query  1102  YDGFMASMDMKTCIDVNECDLN  1123
              DG+  S+ ++   +V   D +
Sbjct  3214  IDGYFYSLILEGLDNVVALDFD  3235


 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 40/73 (55%), Gaps = 1/73 (1%)

Query  423   CINEDGSFKCICKPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCECPPGLAVG  482
             C+ E    KC+C  GF+LA + + C DIDEC   G C + HC N  GSFRC C  G  + 
Sbjct  1364  CVQEPFGAKCLCPLGFLLANDSKTCEDIDECDILGSC-SQHCYNMRGSFRCSCDTGYMLE  1422

Query  483   VDGRVCVDTHMRS  495
              DGR C  T   S
Sbjct  1423  SDGRTCKVTASES  1435


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 36/68 (53%), Gaps = 1/68 (1%)

Query  1456  NCINTFGSFQCECPKGYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYM  1515
             NC +T  SF C C  GY L  + R C DIDEC   P VC    C N +G+Y C C P Y+
Sbjct  3125  NCTDTLTSFYCSCRPGYKLMSDKRTCVDIDECTEMPFVCSQ-KCENVIGSYICKCAPGYL  3183

Query  1516  QVNGGHNC  1523
             +   G  C
Sbjct  3184  REPDGKTC  3191


 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query  82    NCINTVGSYECKCPAGHKQNEATQKCDDIDECSIIPGICEGSECSNTVGSYFCICPRGYV  141
             NC +T+ S+ C C  G+K     + C DIDEC+ +P +C   +C N +GSY C C  GY+
Sbjct  3125  NCTDTLTSFYCSCRPGYKLMSDKRTCVDIDECTEMPFVC-SQKCENVIGSYICKCAPGYL  3183

Query  142   TSTDGSRC  149
                DG  C
Sbjct  3184  REPDGKTC  3191


 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 74/170 (44%), Gaps = 21/170 (12%)

Query  289   CKHHPDLCLNGRCIPTLSSYRCECNMGYKQDSNGDCTDVDECTSNPCSNGDCVNTPGSYY  348
             C+ +   C NGRCI    ++ C        D + DC D  +   + C   +    P  + 
Sbjct  3032  CQQNQFTCQNGRCIS--KTFVC--------DEDNDCGDGSDELMHLCHTPEPTCPPHEFK  3081

Query  349   C---KCHAGFQRTPTKQACID--------IDECIQNGVLCKNGRCVNTDGSFQCICNAGF  397
             C   +C    +       C+D        I+EC    +   +  C +T  SF C C  G+
Sbjct  3082  CDNGRCIEMMKLCNHLDDCLDNSDEKGCGINECHDPSISGCDHNCTDTLTSFYCSCRPGY  3141

Query  398   ELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYC  447
             +L +D + CVD DECT      +  C N  GS+ C C PG++  P+G+ C
Sbjct  3142  KLMSDKRTCVDIDECTEMPFVCSQKCENVIGSYICKCAPGYLREPDGKTC  3191


 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 70/265 (26%), Positives = 108/265 (41%), Gaps = 33/265 (12%)

Query  560   INECALDPDICS-NGICENLRGSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLCR  618
             INEC  DP I   +  C +   S+ C+C  GY+     R CVDIDEC+    +C    C 
Sbjct  3111  INECH-DPSISGCDHNCTDTLTSFYCSCRPGYKLMSDKRTCVDIDECTEMPFVCSQK-CE  3168

Query  619   NTPGSYSCTCPKGYVFSTETDTCEDINECESSPCVNGACRNNLGSFNCECSPGSK----L  674
             N  GSY C C  GY+   +  TC   +  E  P +  + R  L +   +    S     L
Sbjct  3169  NVIGSYICKCAPGYLREPDGKTCRQNSNIE--PYLIFSNRYYLRNLTIDGYFYSLILEGL  3226

Query  675   DSTGLICIDSL-KGTCWLNIQDSRCE-VNINGATLKSECCATLGAAWGSPCERCELDTAC  732
             D+   +  D + K   W++ Q    E + +N    ++     L AA     E   +D   
Sbjct  3227  DNVVALDFDRVEKRLYWIDTQRQVIERMFLNKTNKETIINHRLPAA-----ESLAVDWVS  3281

Query  733   SRGF---ARVNGVTCEDVNECDVFPGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDI  789
              + +   AR++G+   D+N             C+++  +F  + P GL L          
Sbjct  3282  RKLYWLDARLDGLFVSDLNGGH---RRMLAQHCVDANNTFCFDNPRGLAL----------  3328

Query  790   RMEQCYLTWDEDECIRSVPGKFRMD  814
               +  YL W  D   R+  G+  MD
Sbjct  3329  HPQYGYLYW-ADWGHRAYIGRVGMD  3352


 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 96/244 (39%), Gaps = 56/244 (23%)

Query  295   LCLNGR-----CIPTLSSYRCE----CNMGYKQDSNGDCTDVDECTSNPCSNGDCVNTPG  345
             LC+N R     CIP   S+ C+    C  GY  D N +CT    C+ N  + G  +  P 
Sbjct  2954  LCVNDRPPDRRCIP--QSWVCDGDVDCTDGY--DENQNCTR-RTCSENEFTCGYGLCIPK  3008

Query  346   SYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNT-----------DGS--FQCI  392
              + C  H        ++ C+    C QN   C+NGRC++            DGS     +
Sbjct  3009  IFRCDRHNDCGDYSDERGCL-YQTCQQNQFTCQNGRCISKTFVCDEDNDCGDGSDELMHL  3067

Query  393   CNAG------FELTTDGKNCVDHDE-CTTTNMCLNGM---------------------CI  424
             C+         E   D   C++  + C   + CL+                       C 
Sbjct  3068  CHTPEPTCPPHEFKCDNGRCIEMMKLCNHLDDCLDNSDEKGCGINECHDPSISGCDHNCT  3127

Query  425   NEDGSFKCICKPGFVLAPNGRYCTDIDECQTSGICMNGHCINTEGSFRCECPPGLAVGVD  484
             +   SF C C+PG+ L  + R C DIDEC       +  C N  GS+ C+C PG     D
Sbjct  3128  DTLTSFYCSCRPGYKLMSDKRTCVDIDECTEMPFVCSQKCENVIGSYICKCAPGYLREPD  3187

Query  485   GRVC  488
             G+ C
Sbjct  3188  GKTC  3191


 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 38/67 (57%), Gaps = 1/67 (1%)

Query  1255  QCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYEL  1314
             +C+  P   +C C +GF  A+DSK+C+DI+EC     C    C N+ G F C CD GY L
Sbjct  1363  ECVQEPFGAKCLCPLGFLLANDSKTCEDIDECDILGSCS-QHCYNMRGSFRCSCDTGYML  1421

Query  1315  DRTGGNC  1321
             +  G  C
Sbjct  1422  ESDGRTC  1428


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 47/89 (53%), Gaps = 10/89 (11%)

Query  1758  HNNDCMD--------IDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTN  1809
             H +DC+D        I+EC       C +  C + + SF C C  GY+L  D + C+D +
Sbjct  3096  HLDDCLDNSDEKGCGINECHDPSISGC-DHNCTDTLTSFYCSCRPGYKLMSDKRTCVDID  3154

Query  1810  ECVALPGSCSPGTCQNLEGSFRCICPPGY  1838
             EC  +P  CS   C+N+ GS+ C C PGY
Sbjct  3155  ECTEMPFVCSQ-KCENVIGSYICKCAPGY  3182


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 2/58 (3%)

Query  1012  GTYQCSCNSGYQATP-DRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPD  1068
             G + CSC +G++    DR SC DI+EC    G C  HC N++GSYEC C+DG+  M D
Sbjct  3985  GGFICSCTAGFETNVFDRTSCLDINECEQF-GTCPQHCRNTKGSYECVCADGFTSMSD  4041


> sp|Q8NFT8|DNER_HUMAN Delta and Notch-like epidermal growth factor-related 
receptor OS=Homo sapiens GN=DNER PE=1 SV=1
Length=737

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 71/231 (31%), Positives = 108/231 (47%), Gaps = 22/231 (10%)

Query  1652  CQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDMQGSYKCICH  1711
             C+  A CI+S   + C+C  G+  S   AC ++ +        ++G C      + C C 
Sbjct  401   CRNGATCISSLSGFTCQCPEGYFGS---ACEEKVDPCASSPCQNNGTCYVDGVHFTCNCS  457

Query  1712  NGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSF  1771
              GF      T    +D C   PC +GTC++   SY CLC PG+   +  +  + +EC S 
Sbjct  458   PGFTGP---TCAQLIDFCALSPCAHGTCRSVGTSYKCLCDPGYHGLYCEE--EYNECLS-  511

Query  1772  FGQVCRNGR-CFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSF  1830
                 C N   C + +  ++C+C   Y+    G +C    +  A     +  TC +   + 
Sbjct  512   --APCLNAATCRDLVNGYECVCLAEYK----GTHCELYKDPCANVSCLNGATCDSDGLNG  565

Query  1831  RCICPPGYEVKSESC-IDINECNEDPNICLF-GSCTNTPGGFQCICPTGFV  1879
              CIC PG+    E C IDINEC+ +P  C   GSC + P G+ C CP G+V
Sbjct  566   TCICAPGF--TGEECDIDINECDSNP--CHHGGSCLDQPNGYNCHCPHGWV  612


 Score = 55.8 bits (133),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 72/269 (27%), Positives = 116/269 (43%), Gaps = 36/269 (13%)

Query  929   FECECFDGYESGFMMMKNCMDIDECERNPLLCR-GGTCVNTEGSFQCDCPLGHELSPSRE  987
             F C C  GY       K    ID C  +P  CR G TC+++   F C CP G+  S   E
Sbjct  376   FTCVCLPGYTGELCQSK----IDYCILDP--CRNGATCISSLSGFTCQCPEGYFGSACEE  429

Query  988   ECIDVNECSLSDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTH  1047
             +   V+ C+ S     NG C      + C+C+ G+       +C  + +   ++   H  
Sbjct  430   K---VDPCA-SSPCQNNGTCYVDGVHFTCNCSPGFTGP----TCAQLIDFCALSPCAHGT  481

Query  1048  CTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLC---YDG  1104
             C +   SY+C C  GY     +    + +EC S P + +   C ++   Y C+C   Y G
Sbjct  482   CRSVGTSYKCLCDPGYH---GLYCEEEYNECLSAPCL-NAATCRDLVNGYECVCLAEYKG  537

Query  1105  FMASMDMKTCIDVNECDLNSNICMFGE-CENTKGSFICHCQLGYSVKKGTTGCTDVDECE  1163
                 +    C +V+        C+ G  C++   +  C C  G++   G     D++EC+
Sbjct  538   THCELYKDPCANVS--------CLNGATCDSDGLNGTCICAPGFT---GEECDIDINECD  586

Query  1164  IGAHNCDMHASCVNVPGSFKCSCREGWVG  1192
               ++ C    SC++ P  + C C  GWVG
Sbjct  587   --SNPCHHGGSCLDQPNGYNCHCPHGWVG  613


 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 82/185 (44%), Gaps = 16/185 (9%)

Query  298  NGRCIPTLSSYRCECNMGYKQDSNGDCTDVDECTSNPCSNGDCVNTPGSYYCKCHAGFQR  357
            NG C      + C C+ G+   +      +D C  +PC++G C +   SY C C  G+  
Sbjct  442  NGTCYVDGVHFTCNCSPGFTGPTCAQL--IDFCALSPCAHGTCRSVGTSYKCLCDPGYHG  499

Query  358  TPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNM  417
               ++   + +EC+    L     C +    ++C+C A ++    G +C  + +      
Sbjct  500  LYCEE---EYNECLSAPCL-NAATCRDLVNGYECVCLAEYK----GTHCELYKDPCANVS  551

Query  418  CLNGMCINEDG-SFKCICKPGFVLAPNGRYC-TDIDECQTSGICMNGHCINTEGSFRCEC  475
            CLNG   + DG +  CIC PGF     G  C  DI+EC ++     G C++    + C C
Sbjct  552  CLNGATCDSDGLNGTCICAPGFT----GEECDIDINECDSNPCHHGGSCLDQPNGYNCHC  607

Query  476  PPGLA  480
            P G  
Sbjct  608  PHGWV  612


 Score = 49.7 bits (117),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 81/189 (43%), Gaps = 30/189 (16%)

Query  1135  TKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVP-----GSFKCSCREG  1189
             ++ +F C C+  Y      T C + D C+     C  +ASC++        +F C C  G
Sbjct  330   SEATFSCTCEEQYV----GTFCEEYDACQ--RKPCQNNASCIDANEKQDGSNFTCVCLPG  383

Query  1190  WVG----NGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGFTCSDVDECA  1245
             + G    + I    LD C NG       A C++S   + C C EG+ G       VD CA
Sbjct  384   YTGELCQSKIDYCILDPCRNG-------ATCISSLSGFTCQCPEGYFGSACE-EKVDPCA  435

Query  1246  ENVHLCENGQCLNVPGA-YRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMF  1304
              +   C+N     V G  + C C  GFT      +C  + +    + C  GTC ++   +
Sbjct  436   SSP--CQNNGTCYVDGVHFTCNCSPGFT----GPTCAQLIDFCALSPCAHGTCRSVGTSY  489

Query  1305  HCICDDGYE  1313
              C+CD GY 
Sbjct  490   KCLCDPGYH  498


> sp|O75096|LRP4_HUMAN Low-density lipoprotein receptor-related 
protein 4 OS=Homo sapiens GN=LRP4 PE=1 SV=4
Length=1905

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 83/357 (23%), Positives = 139/357 (39%), Gaps = 37/357 (10%)

Query  900   EERNCTDIDECWISPDLCGSGTCVNTPGS--FECECFDGYESGFMMMKNCMDIDECERNP  957
             +E +C+    C     +C SG C+N       + +C D  +      +NC     C    
Sbjct  221   DESDCSSHQPCRSGEFMCDSGLCINAGWRCDGDADCDDQSDE-----RNCT-TSMCTAEQ  274

Query  958   LLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVN--ECSLSDSLCRNGKCVNMV----  1011
               C  G CV    S++CD       +   E C +    +C+L   LC NG+C+       
Sbjct  275   FRCHSGRCVRL--SWRCDGEDDCADNSDEENCENTGSPQCALDQFLCWNGRCIGQRKLCN  332

Query  1012  GTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALMPDVRT  1071
             G   C  NS      + R  T  + C + NGGC   C    G+ +C+C  GY L  D  T
Sbjct  333   GVNDCGDNSDESPQQNCRPRTGEENCNVNNGGCAQKCQMVRGAVQCTCHTGYRLTEDGHT  392

Query  1072  CADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTC---------IDVNECDL  1122
             C D++EC +    C  G CTN  G ++C C  G+    D ++C         +  N  D+
Sbjct  393   CQDVNEC-AEEGYCSQG-CTNSEGAFQCWCETGYELRPDRRSCKALGPEPVLLFANRIDI  450

Query  1123  NSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEI------GAHNCDMHASCV  1176
                +    E      +      L +  ++     +DV    I      G++  ++ ++ +
Sbjct  451   RQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLDRILRANLNGSNVEEVVSTGL  510

Query  1177  NVPGSFKCSC---REGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEG  1230
               PG         +  W  +G   I++    +G H+  +  Q +  P +     +EG
Sbjct  511   ESPGGLAVDWVHDKLYWTDSGTSRIEVANL-DGAHRKVLLWQNLEKPRAIALHPMEG  566


 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 39/70 (56%), Gaps = 1/70 (1%)

Query  381  RCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVL  440
            +C    G+ QC C+ G+ LT DG  C D +EC     C  G C N +G+F+C C+ G+ L
Sbjct  368  KCQMVRGAVQCTCHTGYRLTEDGHTCQDVNECAEEGYCSQG-CTNSEGAFQCWCETGYEL  426

Query  441  APNGRYCTDI  450
             P+ R C  +
Sbjct  427  RPDRRSCKAL  436


 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 36/56 (64%), Gaps = 2/56 (4%)

Query  1786  GSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVK  1841
             G+ +C C+ GY LT DG  C D NEC A  G CS G C N EG+F+C C  GYE++
Sbjct  374   GAVQCTCHTGYRLTEDGHTCQDVNEC-AEEGYCSQG-CTNSEGAFQCWCETGYELR  427


 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 59/130 (45%), Gaps = 32/130 (25%)

Query  295  LCLNGRCIPTLSSYRCECNMGYKQDSNG--DCTD-VDECTSNPC-----------SNGDC  340
            LC NGRCI            G ++  NG  DC D  DE     C           +NG C
Sbjct  318  LCWNGRCI------------GQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCNVNNGGC  365

Query  341  VN----TPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAG  396
                    G+  C CH G++ T     C D++EC + G  C  G C N++G+FQC C  G
Sbjct  366  AQKCQMVRGAVQCTCHTGYRLTEDGHTCQDVNECAEEG-YCSQG-CTNSEGAFQCWCETG  423

Query  397  FELTTDGKNC  406
            +EL  D ++C
Sbjct  424  YELRPDRRSC  433


 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 55/117 (47%), Gaps = 5/117 (4%)

Query  562  ECALDPDICSNGICENLR----GSYRCNCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLC  617
            +CALD  +C NG C   R    G   C  NS   P  + R     + C+VN   C    C
Sbjct  311  QCALDQFLCWNGRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCNVNNGGCAQK-C  369

Query  618  RNTPGSYSCTCPKGYVFSTETDTCEDINECESSPCVNGACRNNLGSFNCECSPGSKL  674
            +   G+  CTC  GY  + +  TC+D+NEC      +  C N+ G+F C C  G +L
Sbjct  370  QMVRGAVQCTCHTGYRLTEDGHTCQDVNECAEEGYCSQGCTNSEGAFQCWCETGYEL  426


 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 34/60 (57%), Gaps = 1/60 (2%)

Query  1255  QCLNVPGAYRCECEMGFTPASDSKSCQDINECSFQNICVFGTCNNLPGMFHCICDDGYEL  1314
             +C  V GA +C C  G+    D  +CQD+NEC+ +  C  G C N  G F C C+ GYEL
Sbjct  368   KCQMVRGAVQCTCHTGYRLTEDGHTCQDVNECAEEGYCSQG-CTNSEGAFQCWCETGYEL  426


> sp|Q9NR61|DLL4_HUMAN Delta-like protein 4 OS=Homo sapiens GN=DLL4 
PE=1 SV=1
Length=685

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 69/239 (29%), Positives = 96/239 (40%), Gaps = 29/239 (12%)

Query  283  NQTIDICKHHPDLCLNGRCIPT--LSSYRCECNMGYKQDSNGDC-TDVDECTSNPCSNG-  338
            +Q ++ C HH   C NG         SY C C  GY   +  DC  ++ EC SNPC NG 
Sbjct  282  DQDLNYCTHH-SPCKNGATCSNSGQRSYTCTCRPGY---TGVDCELELSECDSNPCRNGG  337

Query  339  DCVNTPGSYYCKCHAGFQRTPTKQACID-IDECIQNGVLCKNGRCVNTDGSFQCICNAGF  397
             C +    Y+C C  G+     + + +   D    NG  C+     N   ++ C C   F
Sbjct  338  SCKDQEDGYHCLCPPGYYGLHCEHSTLSCADSPCFNGGSCRE---RNQGANYACECPPNF  394

Query  398  ELTTDGKNCVDHDECTTTNMCLNG-MCINEDGSFKCICKPGFVLAPNGRYC-TDIDECQT  455
                 G NC    +  T+N C NG  C+N   S  C C+PGF     G YC   + +C  
Sbjct  395  T----GSNCEKKVDRCTSNPCANGGQCLNRGPSRMCRCRPGFT----GTYCELHVSDCAR  446

Query  456  SGICMNGHCINTEGSFRCECPPGLA-------VGVDGRVCVDTHMRSTCYGGIKKGACV  507
            +     G C + E    C CP G +         +D         R+TCY  +     V
Sbjct  447  NPCAHGGTCHDLENGLMCTCPAGFSGRRCEVRTSIDACASSPCFNRATCYTDLSTDTFV  505


> sp|P01130|LDLR_HUMAN Low-density lipoprotein receptor OS=Homo 
sapiens GN=LDLR PE=1 SV=1
Length=860

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 78/179 (44%), Gaps = 27/179 (15%)

Query  950   IDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREECIDVNECSLSDSL-CRNGKCV  1008
             +  C  +   C  G C++  GS QCD     +       C++V  C   +   C +G+C+
Sbjct  233   VATCRPDEFQCSDGNCIH--GSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECI  290

Query  1009  NMVGTYQCSCNSGYQATPDRRSCTD----------IDECMIMNGGCHTHCTNSEGSYECS  1058
                 T    CN         R C D           +EC+  NGGC   C + +  YEC 
Sbjct  291   ----TLDKVCNMA-------RDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECL  339

Query  1059  CSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDV  1117
             C DG+ L+   R C DIDEC+ +PD C    C N+ G Y+C C +GF      K C  V
Sbjct  340   CPDGFQLVAQ-RRCEDIDECQ-DPDTC-SQLCVNLEGGYKCQCEEGFQLDPHTKACKAV  395


 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 42/79 (53%), Gaps = 2/79 (3%)

Query  1284  NECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDVDECADPINCVNGLCVNTPG  1343
             NEC   N      CN+L   + C+C DG++L      C D+DEC DP  C + LCVN  G
Sbjct  316   NECLDNNGGCSHVCNDLKIGYECLCPDGFQL-VAQRRCEDIDECQDPDTC-SQLCVNLEG  373

Query  1344  RYECNCPPDFQLNPTGVGC  1362
              Y+C C   FQL+P    C
Sbjct  374   GYKCQCEEGFQLDPHTKAC  392


 Score = 50.4 bits (119),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 4/81 (5%)

Query  1808  TNECVALPGSCSPGTCQNLEGSFRCICPPGYE-VKSESCIDINECNEDPNICLFGSCTNT  1866
             TNEC+   G CS   C +L+  + C+CP G++ V    C DI+EC +DP+ C    C N 
Sbjct  315   TNECLDNNGGCS-HVCNDLKIGYECLCPDGFQLVAQRRCEDIDEC-QDPDTC-SQLCVNL  371

Query  1867  PGGFQCICPTGFVLSDNGRRC  1887
              GG++C C  GF L  + + C
Sbjct  372   EGGYKCQCEEGFQLDPHTKAC  392


 Score = 50.4 bits (119),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 56/130 (43%), Gaps = 16/130 (12%)

Query  1644  ECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDMQ  1703
             EC   D +C    DC +       EC               NECL+    CSH +C D++
Sbjct  288   ECITLDKVCNMARDCRDWSDEPIKECGT-------------NECLDNNGGCSH-VCNDLK  333

Query  1704  GSYKCICHNGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELT-HNNDC  1762
               Y+C+C +GF+    Q  C D+DEC+     +  C N  G Y C C  GF+L  H   C
Sbjct  334   IGYECLCPDGFQLVA-QRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKAC  392

Query  1763  MDIDECSSFF  1772
               +   +  F
Sbjct  393   KAVGSIAYLF  402


> sp|Q14114|LRP8_HUMAN Low-density lipoprotein receptor-related 
protein 8 OS=Homo sapiens GN=LRP8 PE=1 SV=4
Length=963

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 75/169 (44%), Gaps = 31/169 (18%)

Query  958   LLCRGGTCVN-----------TEGSFQCDCPLGHELSPSREECIDVNECSLSDSLCRNGK  1006
               CR G CV+            + S + DCPLG               C   +  C +G 
Sbjct  265   FACRSGECVHLGWRCDGDRDCKDKSDEADCPLG--------------TCRGDEFQCGDGT  310

Query  1007  CVNMVGTYQCSCNSGYQATPDRRSCTD-IDECMIMNGGCHTHCTNSEGSYECSCSDGYAL  1065
             CV  +    C+         D   C   ++EC+  NGGC   CT+ +  +EC+C  G+ L
Sbjct  311   CV--LAIKHCNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHICTDLKIGFECTCPAGFQL  368

Query  1066  MPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTC  1114
             + D +TC DIDEC+ +PD C    C N  G ++C CY G+   +  K C
Sbjct  369   L-DQKTCGDIDECK-DPDAC-SQICVNYKGYFKCECYPGYEMDLLTKNC  414


 Score = 52.8 bits (125),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 5/83 (6%)

Query  865  INECKVFPGMCMNGKCRNTIGSFKCKCNSGFTLDMEERNCTDIDECWISPDLCGSGTCVN  924
            +NEC    G C +  C +    F+C C +GF L ++++ C DIDEC   PD C S  CVN
Sbjct  337  LNECLHNNGGCSH-ICTDLKIGFECTCPAGFQL-LDQKTCGDIDEC-KDPDAC-SQICVN  392

Query  925  TPGSFECECFDGYESGFMMMKNC  947
              G F+CEC+ GYE   ++ KNC
Sbjct  393  YKGYFKCECYPGYEMD-LLTKNC  414


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 2/72 (3%)

Query  1685  NECLEIPNVCSHGLCVDMQGSYKCICHNGFKASQDQTMCMDVDECERHPCGNGTCKNTVG  1744
             NECL     CSH +C D++  ++C C  GF+   DQ  C D+DEC+     +  C N  G
Sbjct  338   NECLHNNGGCSH-ICTDLKIGFECTCPAGFQL-LDQKTCGDIDECKDPDACSQICVNYKG  395

Query  1745  SYNCLCYPGFEL  1756
              + C CYPG+E+
Sbjct  396   YFKCECYPGYEM  407


> sp|Q07954|LRP1_HUMAN Prolow-density lipoprotein receptor-related 
protein 1 OS=Homo sapiens GN=LRP1 PE=1 SV=2
Length=4544

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 46/91 (51%), Gaps = 1/91 (1%)

Query  1007  CVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMNGGCHTHCTNSEGSYECSCSDGYALM  1066
             CV  +    C CNS +Q   D ++C D DEC +  G C   CTN++GS+ C C +GY L 
Sbjct  124   CVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVY-GTCSQLCTNTDGSFICGCVEGYLLQ  182

Query  1067  PDVRTCADIDECESNPDICDGGQCTNIPGEY  1097
             PD R+C   +E    P +       NI   Y
Sbjct  183   PDNRSCKAKNEPVDRPPVLLIANSQNILATY  213


 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 75/166 (45%), Gaps = 32/166 (19%)

Query  296   CLNGRCIPTLSSYRCECNMGYKQDSNGDCTD-VDECTSNP----------------CSNG  338
             C NGRC   LSS + EC      D   DC D  DE   NP                CS+G
Sbjct  2865  CANGRC---LSSRQWEC------DGENDCHDQSDEAPKNPHCTSQEHKCNASSQFLCSSG  2915

Query  339   DCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFE  398
              CV    +  C        +  ++ C  I+EC+   +   +  C +    F+C C  GF 
Sbjct  2916  RCVAE--ALLCNGQDDCGDSSDERGC-HINECLSRKLSGCSQDCEDLKIGFKCRCRPGFR  2972

Query  399   LTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNG  444
             L  DG+ C D DEC+TT  C +  CIN  GS+KC+C  G+  AP G
Sbjct  2973  LKDDGRTCADVDECSTTFPC-SQRCINTHGSYKCLCVEGY--APRG  3015


 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 1/72 (1%)

Query  381  RCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVL  440
             CV T     C CN+ F+L  DGK C D DEC+    C + +C N DGSF C C  G++L
Sbjct  123  HCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTC-SQLCTNTDGSFICGCVEGYLL  181

Query  441  APNGRYCTDIDE  452
             P+ R C   +E
Sbjct  182  QPDNRSCKAKNE  193


 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 62/131 (47%), Gaps = 9/131 (7%)

Query  584  CNCNSGYEPDPSGRNCVDIDECSVNRLLCDNGLCRNTPGSYSCTCPKGYVFSTETDTCED  643
            C CNS ++    G+ C D DECSV      + LC NT GS+ C C +GY+   +  +C+ 
Sbjct  133  CYCNSSFQLQADGKTCKDFDECSVYGTC--SQLCTNTDGSFICGCVEGYLLQPDNRSCKA  190

Query  644  INE-CESSPCVNGACRNNL------GSFNCECSPGSKLDSTGLICIDSLKGTCWLNIQDS  696
             NE  +  P +  A   N+      G+     +P S   +T +    + +  CW+++ DS
Sbjct  191  KNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDS  250

Query  697  RCEVNINGATL  707
              +  +  A +
Sbjct  251  AAQTQLKCARM  261


 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 54/109 (50%), Gaps = 6/109 (6%)

Query  998   SDSLCRNGKCVNMVGTYQCSCNSGYQATPDRRSCTDIDECMIMN-GGCHTHCTNSEGSYE  1056
             S  LC +G+CV       C+       + D R C  I+EC+     GC   C + +  ++
Sbjct  2908  SQFLCSSGRCV--AEALLCNGQDDCGDSSDERGC-HINECLSRKLSGCSQDCEDLKIGFK  2964

Query  1057  CSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCYDGF  1105
             C C  G+ L  D RTCAD+DEC +        +C N  G Y+CLC +G+
Sbjct  2965  CRCRPGFRLKDDGRTCADVDECSTTFPCSQ--RCINTHGSYKCLCVEGY  3011


 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 58/150 (39%), Gaps = 2/150 (1%)

Query  1043  GCHTHCTNSEGSYECSCSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRCLCY  1102
             GC  HC  +     C C+  + L  D +TC D DEC S    C    CTN  G + C C 
Sbjct  119   GCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDEC-SVYGTC-SQLCTNTDGSFICGCV  176

Query  1103  DGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDEC  1162
             +G++   D ++C   NE      + +    +N   +++   Q+       T   T +D  
Sbjct  177   EGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFS  236

Query  1163  EIGAHNCDMHASCVNVPGSFKCSCREGWVG  1192
                   C +H          KC+   G  G
Sbjct  237   YANETVCWVHVGDSAAQTQLKCARMPGLKG  266


> sp|P49747|COMP_HUMAN Cartilage oligomeric matrix protein OS=Homo 
sapiens GN=COMP PE=1 SV=2
Length=757

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 79/165 (48%), Gaps = 24/165 (15%)

Query  1114  CIDVNECDLNSNICM-FGECENTKGSFICH-CQLGYS-----------VKKGTTGCTDVD  1160
             C DVNEC  N++ C     C NT   F C  C  GYS            K     CTD++
Sbjct  125   CTDVNEC--NAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTDIN  182

Query  1161  ECEIGAHNCDMHASCVNVPGSFKCS-CREGWVGN---GIKCIDLDECSNGT-HQCSVNAQ  1215
             ECE G HNC  ++ C+N  GSF+C  C+ G+VG+   G +      C +G+  +C  +A 
Sbjct  183   ECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEHAD  242

Query  1216  CV-NSPGSYLCACVEGFTGDGFTC---SDVDECAENVHLCENGQC  1256
             CV    GS  C C  G+ G+G  C   +D+D   +    C   QC
Sbjct  243   CVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQC  287


> sp|O75093|SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens 
GN=SLIT1 PE=2 SV=4
Length=1534

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 99/218 (45%), Gaps = 33/218 (15%)

Query  1067  PDVRTCADIDECESNPDICDGGQCTNIPGE-YRCLCYDGFMASMDMKTCIDVNECDLNSN  1125
             P +   A  D C S+P   + G C N P E YRC C  G+             +C+++ +
Sbjct  918   PTLAVQAKCDLCLSSP-CQNQGTCHNDPLEVYRCACPSGYKG----------RDCEVSLD  966

Query  1126  ICMFGECEN---------TKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCV  1176
              C  G CEN             F C C  G+   +G T   + D+C    H C     CV
Sbjct  967   SCSSGPCENGGTCHAQEGEDAPFTCSCPTGF---EGPTCGVNTDDCV--DHACANGGVCV  1021

Query  1177  NVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFTGDGF  1236
             +  G++ C C   + G   + + +D CS   + C   AQCV +P    C C+ G+ GD  
Sbjct  1022  DGVGNYTCQCPLQYEGKACEQL-VDLCSPDLNPCQHEAQCVGTPDGPRCECMPGYAGD--  1078

Query  1237  TCSD-VDECAENVHLCENG-QCLNVPGAYRCECEMGFT  1272
              CS+  D+C +  H C+NG QC++   +Y C C  G++
Sbjct  1079  NCSENQDDCRD--HRCQNGAQCMDEVNSYSCLCAEGYS  1114


 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 83/186 (45%), Gaps = 23/186 (12%)

Query  1055  YECSCSDGYALMPDVRTC-ADIDECESNPDICD-GGQCTNIPGE---YRCLCYDGFMASM  1109
             Y C+C  GY      R C   +D C S P  C+ GG C    GE   + C C  GF    
Sbjct  948   YRCACPSGY----KGRDCEVSLDSCSSGP--CENGGTCHAQEGEDAPFTCSCPTGF----  997

Query  1110  DMKTCIDVNECDLNSNICMFG-ECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHN  1168
             +  TC  VN  D   + C  G  C +  G++ C C L Y   +G      VD C    + 
Sbjct  998   EGPTC-GVNTDDCVDHACANGGVCVDGVGNYTCQCPLQY---EGKACEQLVDLCSPDLNP  1053

Query  1169  CDMHASCVNVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSVNAQCVNSPGSYLCACV  1228
             C   A CV  P   +C C  G+ G+     + D+C +  H+C   AQC++   SY C C 
Sbjct  1054  CQHEAQCVGTPDGPRCECMPGYAGDNCS-ENQDDCRD--HRCQNGAQCMDEVNSYSCLCA  1110

Query  1229  EGFTGD  1234
             EG++G 
Sbjct  1111  EGYSGQ  1116


 Score = 53.1 bits (126),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 78/164 (48%), Gaps = 17/164 (10%)

Query  1598  VDIDECKEIPGICANG-VCINQIGSFRCECPTGFSYNDLLLVCED-IDECSNGDNLCQRN  1655
             V+ D+C  +   CANG VC++ +G++ C+CP  +        CE  +D CS   N CQ  
Sbjct  1004  VNTDDC--VDHACANGGVCVDGVGNYTCQCPLQYEGK----ACEQLVDLCSPDLNPCQHE  1057

Query  1656  ADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGL-CVDMQGSYKCICHNGF  1714
             A C+ +P   RCEC  G+  + +    ++++C +  + C +G  C+D   SY C+C  G+
Sbjct  1058  AQCVGTPDGPRCECMPGY--AGDNCSENQDDCRD--HRCQNGAQCMDEVNSYSCLCAEGY  1113

Query  1715  KASQ---DQTMCMDVDECERHPCGNGT-CKNTVGSYNCLCYPGF  1754
                       +      CE   C NG  C +      C C PGF
Sbjct  1114  SGQLCEIPPHLPAPKSPCEGTECQNGANCVDQGNRPVCQCLPGF  1157


 Score = 49.7 bits (117),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 59/206 (29%), Positives = 97/206 (47%), Gaps = 38/206 (18%)

Query  1609  ICANGVCINQ-------IGSFRCECPTGFSYNDLLLVCE-DIDECSNGDNLCQRNADCIN  1660
             +C +  C NQ       +  +RC CP+G+   D    CE  +D CS+G   C+    C  
Sbjct  928   LCLSSPCQNQGTCHNDPLEVYRCACPSGYKGRD----CEVSLDSCSSGP--CENGGTCHA  981

Query  1661  SPGS---YRCECAAGFKLSPNGACVDRNECLEIPNVCSHG-LCVDMQGSYKCICHNGFKA  1716
               G    + C C  GF+    G  V+ ++C++  + C++G +CVD  G+Y C C   ++ 
Sbjct  982   QEGEDAPFTCSCPTGFEGPTCG--VNTDDCVD--HACANGGVCVDGVGNYTCQCPLQYEG  1037

Query  1717  SQDQTMCMDVDECERHPCGN-GTCKNTVGSYNCLCYPGFE----LTHNNDCMDIDECSSF  1771
                + + +D+   + +PC +   C  T     C C PG+       + +DC D       
Sbjct  1038  KACEQL-VDLCSPDLNPCQHEAQCVGTPDGPRCECMPGYAGDNCSENQDDCRD-------  1089

Query  1772  FGQVCRNG-RCFNEIGSFKCLCNEGY  1796
                 C+NG +C +E+ S+ CLC EGY
Sbjct  1090  --HRCQNGAQCMDEVNSYSCLCAEGY  1113


> sp|P35443|TSP4_HUMAN Thrombospondin-4 OS=Homo sapiens GN=THBS4 
PE=1 SV=2
Length=961

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 90/204 (44%), Gaps = 43/204 (21%)

Query  1046  THCTNSEGSYECS-CSDGYALMPDVRTCADIDECESNPDICDGGQCTNIPGEYRC-LCYD  1103
               CT+S   ++C  C +GY    +  TC D+DEC+ +P    G  C N+   +RC  C  
Sbjct  299   VQCTDSRDGFQCGPCPEGYT--GNGITCIDVDECKYHP-CYPGVHCINLSPGFRCDACPV  355

Query  1104  GFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECE  1163
             GF   M     I                      SF          K     CTD+DEC 
Sbjct  356   GFTGPMVQGVGI----------------------SF---------AKSNKQVCTDIDECR  384

Query  1164  IGAHNCDMHASCVNVPGSFKCS-CREGWVGNGIK-CIDLDECSN-GTHQCSVNAQCVNS-  1219
              GA  C  ++ CVN  GS++C  C+ G+ G+ I+ C     C N   + CSVNAQC+   
Sbjct  385   NGA--CVPNSICVNTLGSYRCGPCKPGYTGDQIRGCKAERNCRNPELNPCSVNAQCIEER  442

Query  1220  PGSYLCACVEGFTGDGFTC-SDVD  1242
              G   C C  G+ GDG+ C  DVD
Sbjct  443   QGDVTCVCGVGWAGDGYICGKDVD  466


 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 57/116 (49%), Gaps = 19/116 (16%)

Query  1173  ASCVNVPGSFKCS-CREGWVGNGIKCIDLDECSNGTHQCSVNAQCVN-SPGSYLCACVEG  1230
               C +    F+C  C EG+ GNGI CID+DEC    H C     C+N SPG    AC  G
Sbjct  299   VQCTDSRDGFQCGPCPEGYTGNGITCIDVDECK--YHPCYPGVHCINLSPGFRCDACPVG  356

Query  1231  FTG-------------DGFTCSDVDECAENVHLCENGQCLNVPGAYRC-ECEMGFT  1272
             FTG             +   C+D+DEC  N     N  C+N  G+YRC  C+ G+T
Sbjct  357   FTGPMVQGVGISFAKSNKQVCTDIDEC-RNGACVPNSICVNTLGSYRCGPCKPGYT  411


 Score = 50.1 bits (118),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 66/129 (51%), Gaps = 23/129 (18%)

Query  1123  NSNICMFG-ECENTKGSFIC-HCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCVNVPG  1180
             +SN C  G +C +++  F C  C  GY+   G T C DVDEC+   H C     C+N+  
Sbjct  291   DSNPCFRGVQCTDSRDGFQCGPCPEGYT-GNGIT-CIDVDECKY--HPCYPGVHCINLSP  346

Query  1181  SFKC-SCREGWVGNGIK-------------CIDLDECSNGTHQCSVNAQCVNSPGSYLCA  1226
              F+C +C  G+ G  ++             C D+DEC NG   C  N+ CVN+ GSY C 
Sbjct  347   GFRCDACPVGFTGPMVQGVGISFAKSNKQVCTDIDECRNGA--CVPNSICVNTLGSYRCG  404

Query  1227  -CVEGFTGD  1234
              C  G+TGD
Sbjct  405   PCKPGYTGD  413


 Score = 49.3 bits (116),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 75/165 (45%), Gaps = 28/165 (17%)

Query  1598  VDIDECKEIPGICANGV-CINQIGSFRCE-CPTGFS-----------YNDLLLVCEDIDE  1644
             +D+DECK  P  C  GV CIN    FRC+ CP GF+                 VC DIDE
Sbjct  325   IDVDECKYHP--CYPGVHCINLSPGFRCDACPVGFTGPMVQGVGISFAKSNKQVCTDIDE  382

Query  1645  CSNGDNLCQRNADCINSPGSYRC-ECAAGFKLSPNGACVDRNECLEIP-NVCS-HGLCV-  1700
             C NG   C  N+ C+N+ GSYRC  C  G+       C     C     N CS +  C+ 
Sbjct  383   CRNG--ACVPNSICVNTLGSYRCGPCKPGYTGDQIRGCKAERNCRNPELNPCSVNAQCIE  440

Query  1701  DMQGSYKCICHNGFKASQDQTMC---MDVDEC--ERHPCGNGTCK  1740
             + QG   C+C  G+    D  +C   +D+D    E  PC    CK
Sbjct  441   ERQGDVTCVCGVGWAG--DGYICGKDVDIDSYPDEELPCSARNCK  483


> sp|O75094|SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens 
GN=SLIT3 PE=2 SV=3
Length=1523

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 63/149 (42%), Gaps = 13/149 (9%)

Query  1612  NGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAA  1671
             N  C++ I ++ C CP  ++     L  E ID C    NLCQ  A CI     + CEC  
Sbjct  1008  NATCVDGINNYVCICPPNYTGE---LCDEVIDHCVPELNLCQHEAKCIPLDKGFSCECVP  1064

Query  1672  GFKLSPNGACVDRNECLEIPNVCSHGL-CVDMQGSYKCICHNGFKA----SQDQTMCMDV  1726
             G+  S      D ++C  + + C HG  CVD    Y C C  GF           + +  
Sbjct  1065  GY--SGKLCETDNDDC--VAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPPPMVLLQT  1120

Query  1727  DECERHPCGNGT-CKNTVGSYNCLCYPGF  1754
               C+++ C NG  C        C C PGF
Sbjct  1121  SPCDQYECQNGAQCIVVQQEPTCRCPPGF  1149


> sp|P21941|MATN1_HUMAN Cartilage matrix protein OS=Homo sapiens 
GN=MATN1 PE=1 SV=1
Length=496

 Score = 50.1 bits (118),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 28/45 (62%), Gaps = 4/45 (9%)

Query  1197  CIDLDECSNGTHQCSVNAQCVNSPGSYLCACVEGFT--GDGFTCS  1239
             C+  D C+ G H C     C++SPGSY CAC EGFT   DG TC+
Sbjct  221   CVVSDLCATGDHDCE--QVCISSPGSYTCACHEGFTLNSDGKTCN  263


> sp|P80370|DLK1_HUMAN Protein delta homolog 1 OS=Homo sapiens 
GN=DLK1 PE=1 SV=3
Length=383

 Score = 48.9 bits (115),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 75/165 (45%), Gaps = 22/165 (13%)

Query  1599  DIDECKEIPGICANG-VCIN-QIGSFRCECPTGFSYNDLLLVCEDID-ECSNGDNLCQRN  1655
             D+  C   P  CAN   C++   G + C C  G+S  D    C+  D  C    + CQ  
Sbjct  88    DVRACSSAP--CANNRTCVSLDDGLYECSCAPGYSGKD----CQKKDGPCVINGSPCQHG  141

Query  1656  ADCINSPGSYR---CECAAGFKLSPNGACVDRNECLEIPNVCSH-GLCVDMQGSYKCICH  1711
               C++  G      C C  GF  S N   +  N C   PN C + G+C D+ G ++C C 
Sbjct  142   GTCVDDEGRASHASCLCPPGF--SGNFCEIVANSC--TPNPCENDGVCTDIGGDFRCRCP  197

Query  1712  NGFKASQDQTMCMDVDECERHPCGNG-TC-KNTVGSYNCLCYPGF  1754
              GF    D+T    V  C   PC NG TC ++T  SY CLC P F
Sbjct  198   AGFI---DKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEF  239



Lambda      K        H        a         alpha
   0.322    0.140    0.492    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7278285780


  Database: uniprot-human-reactome.fasta
    Posted date:  Feb 26, 2015  3:52 PM
  Number of letters in database: 4,589,100
  Number of sequences in database:  7,664



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40